SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024396-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW024396-PA
Domain Number 1 Region: 32-77
Classification Level Classification E-value
Superfamily RING/U-box 0.000000179
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW024396-PA
Sequence length 89
Comment secreted protein, putative|DS765275:1028:1294:-1|gene:ISCW024396
Sequence
MSATAASYRVVGFQTGLNWRPLAFEKPPPAIRVCSLCGVVPRTTLVLPCSHALCEPCFAA
TEGKGRVCPLDGHAYDQDTVGRLQLPPDQ
Download sequence
Identical sequences B7PQI3
ISCW024396-PA XP_002436025.1.51680 6945.ISCW024396-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]