SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024454-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW024454-PA
Domain Number 1 Region: 245-563
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-32
Family NHL repeat 0.0077
Further Details:      
 
Domain Number 2 Region: 84-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.99e-22
Family Glutathione peroxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW024454-PA
Sequence length 621
Comment NHL repeat-containing protein|DS783599:2005:6681:-1|gene:ISCW024454
Sequence
PIFVPAPCTTCTPAPRMHTEKMTGAEYPSSLLRLRELQESFEREYKDAETEDRNSLIHRY
IASVDDSDDRFLLGDFGSDMDWINTSRPLTASDLRGRVVVLDFFTFCCINCQHVLPEIKR
LEEELPPSSGLLVVGIHSAKFQHEKRPSSVGQAVQRLGINHPVVNDSSSRLWRKLWVNCW
PTMVVLGPSSQALLVLVGEGSTSFLHLFCRAAVDHFGPDLRLSALPLDPGGTPLSKPLHF
PAKVFATETRLVVADTGHHRVLVADHDGRVLYTVGSPEPGWRDGALNDARFNGPQGVVWR
DPHFVYVADTGNHTVREVDLEQAQVRTVAGTGQRGSDLEGGRQGPQQPLSSPWDLCLVED
ILFIAMAGSHQLWALALRDSQLFGKLHLGAGTCLRIAGSGSEENRNNSYPLRASFAQPSG
IAFHPPDVLCIADSESSAIRTLSLRTGAVKNLVGGALNPTDLFCFGDADGSALDVRLQHP
LGVCWSSDKQLLYVADSYNHKIRKVDVQKRLCTTLAGTGVAGDATGSFSDEVQFDEPGGL
CVVGSRLYVADTNNHCVKLVHLDLGFVEKVTLTLPDATDSRDEDSASMDVSRVALAPEAC
LRLVLELPADLAPGAPHQWRL
Download sequence
Identical sequences B7PT46
ISCW024454-PA XP_002403871.1.51680 6945.ISCW024454-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]