SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024710-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW024710-PA
Domain Number 1 Region: 26-97
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000487
Family Growth factor receptor domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW024710-PA
Sequence length 109
Comment secreted protein, putative|DS863642:1145:3784:-1|gene:ISCW024710
Sequence
YTSTNIVFHLSLSRVQSTSPPNCALVNCAYEHCSPVNCACGSYKGSCGCCDVCYKCANEA
CVILHQHRCEEGTECRLNNPEESISQGAQGTCIRKPSTEGPHGHSHNEK
Download sequence
Identical sequences B7Q5W0
6945.ISCW024710-PA XP_002411826.1.51680 ISCW024710-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]