SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024727-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW024727-PA
Domain Number 1 Region: 43-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-55
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000024
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW024727-PA
Sequence length 251
Comment SPRY domain SOCS box-containing protein|DS921462:248:1089:-1|gene:ISCW024727
Sequence
KWPNLPPNVLEHIFSYLDLSSSRSCSLVCKSWYVLLNDENNDVWRMHCVRKLAEEALKSD
LLWSVPSCKAKLRALYHAWDPRECSRNIYIKPNGFTLHRNPVAQSTDAAKGKLGFAAGRH
CWEVWWEGPLGTVAVVGIATKEAPLQCPGYVALLGSNAESWGWNLVDNHLLHDGDSQGNY
PLLNNAPKYQVGERIRVILDCEDNTLAFERNYQFLGVAFRGLPDKKLYPAISAVYGNTEV
SMVYLGHPLDG
Download sequence
Identical sequences B7QEK9 V5I0E7
XP_002413973.1.51680 ISCW024727-PA 6945.ISCW024727-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]