SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW002825-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW002825-PA
Domain Number 1 Region: 466-568
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000663
Family I set domains 0.061
Further Details:      
 
Domain Number 2 Region: 118-221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000458
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 250-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW002825-PA
Sequence length 637
Comment hypothetical protein|DS663217:1600:30001:-1|gene:ISCW002825
Sequence
VRSPWRSTQPGEKTVVDALTDPKTTRCRGLQVSFLFNGISGRRSRGYSPGIARAVPTSFA
SFQRSPKKPDPDPHHELKEVSLGRRGAAMGARKSQLPSALAAVAAFLTNSLAGAVFRDCG
FVSDRERGVITTPGFPGPYPVPIECRWVMRGSSPKQRVALYLTQFYMRDGVTLSEYVYYD
AQQGNIGGTPIGGISSEAEPTHVLSNKPVLVLDFQVREAGNIHLRVLDLFLEVYGFNLTY
ELVESEKELRNDSCLGHHCSFTGLCLASADLTSYRCSCLGDFYGDECQFSPRCGPQKGGS
LCHNGGTCRRVCLDVRRTRFLVQVKLYDRNVDLAHLDARGRSQLQAGLEAALKSLFASHM
SSNVDNLAVLQFLTDAVVQFHVFGRKEDGPAVRSLLEEALKVGKLGPFTVDRGFLQLQEE
PGTVSCYSASLYVRTSPNVSPSDRVSTQVSDWGAVQNKSVRVRLDVAPRPLVSPLSLTLV
EGQPLELLCLSPGGVPLGFRWLRNDHLLPPKGPESTEDLYPAGSRLVLGAARASATYTCV
ATGPLGADRADALVTVLAPHAAEEVCPPEESHGVAWQRTATHSRDIQPCPSPPFVEGQAV
RSCGLSLERRPLWGSPDFSGCADTRLAQLRWKASATA
Download sequence
Identical sequences B7P9F9
ISCW002825-PA XP_002404163.1.51680 6945.ISCW002825-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]