SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004855-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004855-PA
Domain Number 1 Region: 47-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 118-166
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000929
Family Hairy Orange domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW004855-PA
Sequence length 401
Comment conserved hypothetical protein|DS708614:65339:70604:-1|gene:ISCW004855
Sequence
MDTGWEQALRLKMEQRSLNFCALAAERRRQELDDADVRGGKKPARDPMSHRIIEKRRRDR
MNNCLADLSRLIPAVYLKKGRGRVEKTEIIEMAIKHLRHLQAHSCKDPTTCEVAQRVDSD
HRLQYRLGFQECLSETARFLVDLDGSCTADDTCFRLVAHLQKHFDKVSGAGSCYPAGLVL
SDEEATMEPPERQPKQEPTAALPDGSCSSSSSCSSVSQLREMLQNPGLSVQECMRRSSDY
LLAANNGNNNNNNLNNKPPTAEEAYKFKNDIKDRFHKDAQWGGERPDERRHSHSQGSSLV
PVPSPTRHTVSAPPPDPPPENPSPGPGVAAFALHPRGSFYIPVTLDPTLVGPALAYVDES
PQAALHPVSISVQFGRQRPLGPPPWPQCPWRLRLGEPNGCA
Download sequence
Identical sequences B7PGM4
6945.ISCW004855-PA ISCW004855-PA XP_002400926.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]