SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW005723-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW005723-PA
Domain Number 1 Region: 4-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000268
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 39-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000225
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW005723-PA
Sequence length 80
Comment hypothetical protein|DS743146:6940:9926:-1|gene:ISCW005723
Sequence
IEECSETKDDCQWSCLNTQGGYLCQCPVGFKLHQDNKSCVDVNECRTSNGGCQEGCVNLI
GSFRCKCTTAGSSLAADGKK
Download sequence
Identical sequences B7PLT7
XP_002434735.1.51680 6945.ISCW005723-PA ISCW005723-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]