SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW006065-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW006065-PA
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family I set domains 0.025
Further Details:      
 
Weak hits

Sequence:  ISCW006065-PA
Domain Number - Region: 130-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW006065-PA
Sequence length 168
Comment titin, putative|DS735578:223507:245138:1|gene:ISCW006065
Sequence
MCEEMLKPAQAKWLRSTSRADAYRRLQLRCKLNGNPIPWVQWYFMGKPIASNARVHIITK
WRRSRLEIKSARRQDSGLYECRAWNVLRKEPSVVAVNVTVRDRIPPPPTPPEPTRSTAST
TTNGRPCPLVSYCLNGGTCIFYEAVKEPVCQLDLHQLQGVTEPIREKI
Download sequence
Identical sequences B7PKT5
XP_002434383.1.51680 6945.ISCW006065-PA ISCW006065-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]