SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW007213-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW007213-PA
Domain Number 1 Region: 1758-2004
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.45e-53
Family Ankyrin repeat 0.0000000969
Further Details:      
 
Domain Number 2 Region: 1052-1182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000011
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 3 Region: 544-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000149
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 671-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000181
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 5 Region: 775-906
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 396-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 7 Region: 898-1016
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 191-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000982
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 709-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 10 Region: 229-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 116-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 30-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 150-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 14 Region: 267-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000318
Family EGF-type module 0.008
Further Details:      
 
Domain Number 15 Region: 80-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 304-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 346-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 1401-1434
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0049
Further Details:      
 
Domain Number 19 Region: 1361-1393
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1215-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 1441-1474
Classification Level Classification E-value
Superfamily Notch domain 0.000000785
Family Notch domain 0.0023
Further Details:      
 
Domain Number 22 Region: 1178-1222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000866
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ISCW007213-PA
Domain Number - Region: 1301-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000348
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1259-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 520-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00401
Family EGF-type module 0.0094
Further Details:      
 
Domain Number - Region: 1033-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW007213-PA
Sequence length 2298
Comment LIN-12 protein, putative|DS782609:91221:122388:1|gene:ISCW007213
Sequence
MASVIDNQIYAPLGLYSNCPPLFVGEYCQHMNPCQAVSGKRCQNGGTCNVEMSVTSGPSF
SCTCPVGYSASMCEIAVPSACDDRPCRNGGTCSLVTLDNYTCACATGFRGKHCDKKDHCA
SQPCLNYGSCLSRADSYACVCAQGYSGPTCAVDVDECKAKPCEQGTCINTQGSFSCVCEA
GFTGQLCESRYIPCEPSPCLNGGTCRPIDSLNYQCSCPPGFTGTHCEANVDDCPGNLCQN
GATCLDGVNSYTCHCPPTYTGPYCSRDVDECSFRPTVCKNGATCTNTVGGYSCICVNGWT
GTDCSENIDDCAVAACFNGATCHDRVGSFYCQCAPGKTGLLCHLDDACASNPCHEGAICD
TSPIDGTYLCSCPNGFQGVDCTEDVDEEATQGEEEEGYKGIHCEVDIDECLPNPCLNGGI
CNDLINGFKCLCPVGFSGKKCEANEDDCSSFPCRNGGSCHDGIASYTCHCPPGFTGATCE
TNINDCQSSPCHHGVCHDGINSFSCNCHAGYTGLLCQTQINECLSSPCRHGGTCEDLVNG
YQCRCRPGTSGVDCEYNVNECFSNPCRHGAKCIDGIDSYTCDCLAGFTGIHCETNINECA
SNPCSNGGVCTDLVNGFKCDCPRGYFDARCLSDVNECASNPCQNGGTCEDEVNRFVCHCP
PGYGGHRCEQDIDECQSNPCQHGGSCHDTLNAYSCTCIDGYSGRNCETNLDDCSPNPCLN
GGSCIDLVGTFRCVCEVPFSGPTCDVELDPCSPNKCRNGAQCSPSSNYLDFACSCKLGFT
GRLCDEDIDECAVSSPCRNEATCVNVNGSYECLCTRGYEGRDCLTNTDDCASYPCQNGGT
CLDGIGEYTCLCVDGFGGEHCADDMNECASNPCQNGATCNDYVNSYACACLPGFSGTNCQ
TNDEDCTPSSCMNGGTCVDGVNNYTCQCSPGYTGSNCQYHINECDSQPCAHGATCVHHIG
YHTCHCPFGYMGPRCETFVDWCATNPCLNGASCKQSNNTYRCTCQPGWTGLLCDVSMVSC
EDAALQKGTKVADLCKHGGVCEDFGNSHHCLCPEGYEGSYCQREVNECLSNPCQNGATCH
DLLGQYACDCPEGFQGLNCEYDVNDCDPSPCRNGGTCHDLVNKFVCSCPHGTLGTLCEID
VNECFESACHHGGTCLDRVGRYECQCPPGYVGSRCEGDVNECLSSPCDPLGTLDCVQLVN
DYRCDCRPGHAGRRCELKVDPCSTDPCLNGGVCHPGPRGPTCVCQEGFWGETCANRSCGD
ASPCRNGGQCRGQSCVCPRGTSGSFCERLEELGAGGACPLGCRNGGACRKGASGRFECEC
LVGWKGLRCEEYDSSFRGALAPSVEGVYDLFLKSLEEEKKLCAARRCEKKAGNRYCDEEC
NTYACNFDGGDCSLGINPWMNCTAAIKCWDVFRDGKCNVECNNIDCLFDGFDCQKDLQPC
NEHYDTYCMSNYGNGYCDYGCNNEECNWDGLDCEMDPPYLAEGSIVIMISIEPEVFRNNT
VPFLRDIGHALRTNVLFKRDPTGSPMIYPWRATDGQKPNHAALPVPRTGTLVHLEIDNRR
CLKSQGSECFQSAAKAAEFLAAAQARHSLETPFHIQEVQGAGREQGGDGAGDGGRASALH
VVIGLIGVLLAGLLVGVLFTTQKKRARGITWFPEGFLRTGSGQRRHSRRRGPDGQEMRAA
HANGEGPPEAWSDDEGERPPAKRARGSPDSSCGDTVVSDCEEERDPRPWTQQHLEAADVH
HPELLLALTPPQGNDLDQHNVDVRGPGGLTPLMLASFRGNGLDTGEDVGEDDDGSASMIQ
DLLMQGAQLASTTEKTGETPLHLAARYARADAAKRLLDAGAEANAQDSSGRTPLHAAIAA
DAVGVFQILLRNRATNLNAKMNNGMTPLILSIRLAMEGMAEDLINAEADVNAADCDARTP
LHWAAAVNDVTSVRILLAHGANRDAQDIHEETPLFLAAREGSLNAVRALLDHAANRDITN
HMDRRPRDVARDRMHLDIVDLLDKYVPSSQIPGLGSPPMLLSNPTVIGSTKSAKGKRRQQ
PKNNGNASIALQHLDASATSPGAEVNHVKRRPSIKKRREPPMPLPEVPHPLDSPHESPGG
PLFLQQGGVATLTKQPPCYEDCVGPVYTAVYDPQAYANAPMAQQQQHPRQNSVPSMGGYT
MASSPAKQRPSLPTSPTHMAAMRAAHQHKLQQGAPTYDYPVQPAYYHYPTPPSQHSHGGG
PEATPQHYLHPAETYLTPSPESPGQWSSSSPHSAQSDWSEGISSPLGQQALGGCELKQQQ
QQQTVQPAGLTHPDPVFI
Download sequence
Identical sequences B7PT11
ISCW007213-PA XP_002403554.1.51680 6945.ISCW007213-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]