SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008750-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008750-PA
Domain Number 1 Region: 150-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 2 Region: 257-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000769
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 216-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 396-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000687
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ISCW008750-PA
Domain Number - Region: 186-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00541
Family EGF-type module 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW008750-PA
Sequence length 430
Comment hypothetical protein|DS819359:355:33840:-1|gene:ISCW008750
Sequence
MGTTDNPGKILVPPNCPDCPDPWLLTTITEVSLRVTWLEARVDHGSAVREPLPPAPEGGV
VSLQPQVLYLGWLPTHSSERVKRQSSNAWLHRITDYLENVEHFKGVLQDMRLNEEPVPLL
KGRQPQAEDGAALVNVLESSKVDAGVVSDDECSSGPCLNGATCTDIWNAYSCVCPADFRG
KLCEELRPCVRHRCPNQSLCQDLKEGHECKCDQRVWYCERQPCENGATCSDTEPGSYSCL
CSDDFEGENCTLRYRCECGPGHEGRDCERQRDLCASGPCENGASCLIREPGTVECVCAQG
YRGTFCEEFIDLCKEEPPPCLHGGRCNPYVGGFDCYCYGTGYTGSLCQTDVDECKEQQPC
QGGATCINLEGSYACTCPAGRFGRHCQLNDSCWLDQPCHNGAPCTPVEDLHRPFFCNCTQ
GFLGDTCALT
Download sequence
Identical sequences B7PYC6
XP_002402943.1.51680 6945.ISCW008750-PA ISCW008750-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]