SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW008751-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW008751-PA
Domain Number 1 Region: 416-552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 390-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000653
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 3 Region: 43-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000545
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 352-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000472
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 124-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 238-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 195-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 536-664
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000113
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 9 Region: 81-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.023
Further Details:      
 
Domain Number 10 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000786
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 317-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000485
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ISCW008751-PA
Domain Number - Region: 276-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000763
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW008751-PA
Sequence length 665
Comment fibropellin-1, putative|DS819359:34605:60281:-1|gene:ISCW008751
Sequence
CELDIGECQLMPCRNNGTCTQGPAGPLCDCQGTGFEGPRCERDVDECLESPCLSGSTCFN
RWGSFECACPRGRGGRHCERDLDPCEWGTPCHGNATCIAASGNGYLCVCPPGWTGARCDR
STDPCAAGPCRNGATCLADGQGSFDCICAEGFSGRQCQVDENECAAGPCANGATCHDLVM
GWRTATLASFAGERCEADEDDCVGSPCLNGGSCRDALRGRLCDCPAPFLGPDCGQRGDPC
LASPCLNGASCLARDRDPWFECACAPGFGGPTCNLDVDECRGVVCPASMRCVDRVNGYEC
RCVPPGCASEGACPSAGCGVDSCPANALCQDAERGFRCGCRRGWTGPRCSEDVDECRQGL
CEHDAICRNLNGSYQCFCRPGYTGTHCHIEVNECLSQPCQNGATCREGVNQYQCLCPPGY
LGDHCEVDLDECASAPCLNGATCLDQVAGFQCVCAPGYEGTQCEVDVDECQSGPCLNGAP
CLDLVAGFQCVCAPGYEGTQCEVDVDECQSGPCLNGAPCLDLVNGYDNASGYLCLCPPGF
NGTDCENDIDDCAAHDCMHGRCVDLVNAFRCECNAGFEGADCGREVDECSLLAPCENDAI
CHDLVADYRCDCAPDFGGKNCSVALLGCRGGPCHNEGRCEPFLSDAGDHLHRCHCTPGFA
GTACD
Download sequence
Identical sequences B7PYC7
6945.ISCW008751-PA XP_002402944.1.51680 ISCW008751-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]