SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW010083-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW010083-PA
Domain Number 1 Region: 2077-2177
Classification Level Classification E-value
Superfamily Immunoglobulin 4.79e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 1172-1262
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 3 Region: 2350-2446
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-21
Family I set domains 0.0088
Further Details:      
 
Domain Number 4 Region: 1991-2086
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-21
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 2261-2354
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-21
Family I set domains 0.0074
Further Details:      
 
Domain Number 6 Region: 136-222
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 1535-1633
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-20
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 1263-1359
Classification Level Classification E-value
Superfamily Immunoglobulin 1.5e-20
Family I set domains 0.0094
Further Details:      
 
Domain Number 9 Region: 2442-2532
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 974-1073
Classification Level Classification E-value
Superfamily Immunoglobulin 4.17e-20
Family I set domains 0.044
Further Details:      
 
Domain Number 11 Region: 1817-1910
Classification Level Classification E-value
Superfamily Immunoglobulin 4.66e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 2169-2267
Classification Level Classification E-value
Superfamily Immunoglobulin 6.67e-20
Family I set domains 0.0051
Further Details:      
 
Domain Number 13 Region: 420-504
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 14 Region: 799-885
Classification Level Classification E-value
Superfamily Immunoglobulin 3.64e-19
Family I set domains 0.0058
Further Details:      
 
Domain Number 15 Region: 1452-1542
Classification Level Classification E-value
Superfamily Immunoglobulin 4.65e-19
Family I set domains 0.024
Further Details:      
 
Domain Number 16 Region: 608-695
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-19
Family I set domains 0.0083
Further Details:      
 
Domain Number 17 Region: 878-980
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-18
Family I set domains 0.0078
Further Details:      
 
Domain Number 18 Region: 505-598
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 1067-1164
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-18
Family I set domains 0.0095
Further Details:      
 
Domain Number 20 Region: 689-788
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-17
Family I set domains 0.0078
Further Details:      
 
Domain Number 21 Region: 1737-1824
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 22 Region: 314-405
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 23 Region: 1627-1726
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 24 Region: 219-317
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 25 Region: 1903-1994
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000025
Family I set domains 0.026
Further Details:      
 
Domain Number 26 Region: 1370-1458
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000263
Family I set domains 0.022
Further Details:      
 
Domain Number 27 Region: 39-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000294
Family I set domains 0.019
Further Details:      
 
Domain Number 28 Region: 6-48
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000585
Family I set domains 0.03
Further Details:      
 
Domain Number 29 Region: 2529-2577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW010083-PA
Sequence length 2698
Comment hemicentin, putative|DS827319:412437:493603:-1|gene:ISCW010083
Sequence
TAEYPLHLIGVSAKDAGLYVCRASNEVGVTNSTTSVRIRVAPRVQLNPDTVTFGSGDHFE
VACTASGAPAPRVWWAVPAELRSRIEPQGQRLVVHSARAGDEFEEVYCVAANQAGRDTGR
ISLKYLAPPAMDMVQRSYEPLEGSQVSLMCPVHAEPPSEVTWYKDGRRIDPGSEHRIVFR
EDRLYIQAVHTRDTGIYKCTATSAVGESSAEFNLNVLAPPAFKNEVTDATLRVVENVSLS
FDCAVFGNPKPEITWFKDNRAILKTNKLDAFVSSEEQTLKIASTRMLHDGVYTCIANNKV
GRVEAGVLISFLVPPAIHGSVDEKIRAVEGQDVTLECQASGVPIPDLAFFRKGRLVESLG
LGGGRRELRIPAVKTSDAGFYVCRASNEADITEKKFHLDVRAPPAFEDGGSDISSGAIRE
VLLDSPFTLRCPVDGNPTPEVTWFKDDIELTPRGDRSIDITHHGQRLNVPHATEENTGLY
TCKANNELGEILRHYNLQVRVPPYTSPGISDYQTLTPLEGGSLSLSCNISGNPVPAITWL
KDGLPLTPFEFPNIQFLDSGRLLNISSLEVTHSGKYMCIATSKVGSADMTFLVDVLAPAF
IDGSLQDRHQTTMLHQPVTFGCPATGSPPPGIAWFHDGVPVLPSHQGVLMFQEGRLLTLQ
AVLPSSAGIYTCEASNVIGHASLDYILEVLVPPIIRRKNLTSEFWVVEGSTVLLQCPADG
RPPPTIVWLRGAEVLSPESDSRVTISEEDHSLTLKGVRLGDRKFTCLAGNEAGTAEQDYR
VHVMVLPRLEPSVSLTRLVSAVVNRQTTLRCPVVGVPPPALHWLKEGRLLRPKGDPFVQT
SADGRRLLLRRVRLRDGGNYTCVAVNEAGKLEQSYVVDVQVPPRIAGPNIVKIEVVENRA
FAMECHVESLPRAAVYWTRNGLPYESDNLAEGAATPHGSRRLWFPSVRASDRGNYVCVAE
NEAGLAEKTFQVEVNVPPSIHVPEKAISVSESTPTKLRCQVSGIPSPSIFWMHEDDMLYD
NNTKDIGFAENGQIVQIPNAKLEHSGKYTCVATNAAGSAEEQVTLSVLVPPRISKGASPP
PVMLQHPATLECQVEAHPTARIEWTKDGELLESQPLVRALDGGRVLQLVHVTEELEGAYM
CRAANAAGVDDHTLFLSVLDPPKIAGSNDTTTEELAVPLGETLTLPCDSTGDPPPLVSWI
RDGTRLSSTDPFVRFSGDNPSSHLVLKRVRLEDAGRYICVVTNSAGVAEKHFTVTVTVPA
SIVKPKVMAEVNVVSGERATLECSVRGLPKPTVLWFKDGLPILGTERQDARYTFLLGGET
LLVQSSGASDSGSYKCEASNPDGSDELVYKLRVVEPPDFGSRLGVTEVSMVRQGDATVIE
CPFLADERFPTSTRWQWNGKSLAEDLLPPNLALSLNARSIHVVRAQQDNAGRYTCTASNV
AGEAHFTTLLEVLIPPSFDTISKDKISVLEGGSISLECKTHGFPDPVVSWIRDGNKILVD
NPILALFNVNQSDAGTYSCEALNEAGAAQVDFILDVLEPPWFDMSAGRLELTVLEGEEVI
LNCPYRGKPEPRTSWYKEGRRVHPGPSVKISNDSLTIAFARSHDSGTYVCAAISEAGTAE
VNLTLTVYVAPKIHQIESSPIKAIDGHPVRLSCEASGVPAPSIKWLRSNGSSAAETSSGR
ATTEGGFFLDFSDGVQMEDRGRYICMAENEAGVEQEEVFLDVIAPPSINQSDWSGVDILA
ISGQNTSLRCPAIGSPPPEIEWLRDGRSVQRADAAAVDGAHGEVLKILSVRVEDAGEYLC
LARNEGGTVDMKYRLEIVEPPRIFGSQLPMLITSVVGEPTVFECPARGFPLPSISWAKES
VALDSAPKNGTLLIEETQTSDAGTYACTATNSAGIASQEFVLTVHVPPKIRDLPGTMDVV
SGKPLVLECVSDGFPRPNLTWHGPVIAEAVHEHGLLRIANIGKEHAGNYTCTAASEAGTD
FKTTVLNVLTAPTIQKSSEDVVVVAGQPAILWCNTSGDPAPQVTWHKDNRHLQDDSDAFE
ILPNAVYIYTANVSDSGQYVCTVQNHVGSSQAVRNLDVLDPPTITVFYPEERTVVQGSEV
SLVCQARGHPKPTVYWEHNGNLISNQEARYIFVTGGELKIPVAEVKEAGEYRCTAKNQAG
WDTRTTTVTVHVPPTILKEGQEEELTIQRGGQAVLRCKADGFPLPTILWTREGDPISNPR
ARTEASGDLIIDSAELDDSGSYVCVATNAAGVHHRVVSLAVLVPPSISRLPRDQEVAIGQ
PLELSCQAHGSPAPTITWTVNDTAVTEETSEGVSVLALDSVSQLDQGTYVCVAANDVGQH
KASADVKVRAPPRILEAPAAQETHEGHRAMLHCVAQGDPPPKIFWLKDGHQVLTVNSHVQ
QFPNGSILISPTKANDTGEYRCLATNKFGVSEAGAVVTILTPPSFTIKPQDTLVEKGSTL
VLDCSARGIPPPEQSWSKLGHVTILASNRVTLLTNGTLRIHMVNEADEGLYQCKSRSKAG
VATANVQVKVKDIDECEEDDVNCGRNHICFNSRGSYQCMYAPCPDNYVRDTEGSSCRLSC
GDEAACEPRAHFADVLTFKTVALPSGVTAGRDVVRLSARDHDSALLAHTLFTVLSNKRNV
PFDVRVSKGVGIVFATEDLPAGFQYRITLHATTRDDANKTALFETRFFLFVSTSLYPY
Download sequence
Identical sequences B7PZR6
ISCW010083-PA XP_002405927.1.51680 6945.ISCW010083-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]