SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW011066-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW011066-PA
Domain Number 1 Region: 29-215
Classification Level Classification E-value
Superfamily vWA-like 1.36e-34
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1409-1565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.62e-20
Family Pentraxin (pentaxin) 0.024
Further Details:      
 
Domain Number 3 Region: 438-499
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1002-1158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000175
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 5 Region: 1184-1297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000091
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 6 Region: 1293-1329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000466
Family EGF-type module 0.008
Further Details:      
 
Domain Number 7 Region: 1368-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 1333-1373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 9 Region: 385-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000653
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 10 Region: 733-786
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000674
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW011066-PA
Sequence length 1597
Comment neurogenic locus notch, putative|DS853260:8985:61967:-1|gene:ISCW011066
Sequence
MRSVALAVALLLSLTTSPARSLVLDADLQLFVSTIERYSTTKNDIVFVLDESGSIGADVF
PAELAFTEMVARLLVVSPEYSRLTVMTFSNDNLVHIDQVGSSGDTNMCKFVHELNQIPYR
SGGTRTREALGYAGEILWNARQEANRIVVLISDGQANSGSEPSEIARLLRVKGIVIFGVG
VAHINKDELLDVASSPAHTYMLRNFEYIKKVNKDLRKGNGPWDTSALSFGSNHIIVTYNL
PLPPGPAKNSSKAHLTDWNLFRSLLDSLGPQNYAEWQNIVEKQWDEATSSSVCGKQSDAN
AICACGARGGTYQWVCNPGYQEAGTPGQCRPCPRGTYRGAAGNEACLPCPGNSTTKDEGA
RSVSQCSCLAGYEGSPANNLPCTPILCAQLSSPIGGSTLPRKCGNTFNTSCSFKCDEGHS
NPRVCQADKKWSGLEFSCAKVRCPPVNLPPHGRVNCTSSQLDFGTECQVACDPGYNINGS
TSLICQMNGQWDKEPPTCEGKLKPFYNIVDNLTALEYFYLLATRTAMDADVQHCYVYFTY
CGSHNIARRFHTERVNIFVSFADIEKPVLKDCPADKTVVTDPNAPYCSNVTWLEPSAEDN
DDGATVRVVHPPGVTKPPHGFAVGETVVTYIAEDRAGLASEPCSFTVFVTDNQPPVVVFC
PDDIIEFSERSQKNITWEKPIFKDNAGPPNITATRDPGSVFTWGPPSDVTYHATDLDGNV
ANCSFRVVVKPYPCPYYPPPKNGFVTCDSETDRQFCSVYCDQGYEFVSPPAPLYRCKQKV
NKGEWSAFSRNKKLKLPWPDCAVPKKPKKTDYTVDFKFATNSCQVSEEQKQRLKKKFFDA
FKKKVGHVVGMCDPKQGCTVDNVHIDCQSKNKTKIQKRDLSVKKHGRRGSSAASRALQKR
DAVDDDNNDDFESTFRLSFTVPLPEDLNVTELIEACEVGFPIFSSTQKKLLRFTKFRFTI
ARFMPAKSMLSPHSSCRLGTCTHLSVHVFRIINCPVGTYYHNGTTCLPCPIGTYSDLEGA
SSCLSCPDNKTTLSEKSSSPQKLMTLCKPGTFSTSGKEPCMSCDTESYQDISGQASCKKC
PAGLSTGFWGAKESSSCQDACSPGTYSISGTKPCAPCPVGFYQPLRNQTSCMKCENGLST
HTVGSTAKSDCVANTCASDRYEGAPYEEDGSLCFLTDVKTCELLKPCAEGSTCVDLGSTY
TCACPEGLVGPNCENNIDDCAEDLCLNGGVCIDGLNNYTCSCPPGFTGSNCEVNINDCDS
NPCQNGATCIDGVNTFACKCAKGFRGKTCHARYHDCATRPCQNGGSCFDSIDGYRCCCRR
GFTGKSCELIETPCSPNPCEHQGTCVAKGDEYECTCQEGFTGPRCEENVDDCQSSPCLNG
GTCVDGLASFSCNCSGLYTGELCETVRPSNFSLHFPDASVSNYARISVKRNLRAITLSFF
MKTSQSKERGTPVSYAFADPETGAIVDNGLVISDPNKLLLYIFQESYDTNTVANDDDWHH
CAVTWNSKTGQWTFYWDGQSRITGLNIWDYEMSASEIHSLTTSCGNAGNVVAWPELRNGI
EGNIVSSGYPDICMGAPATVDECQTCHCSLNSLENRK
Download sequence
Identical sequences B7Q438
6945.ISCW011066-PA ISCW011066-PA XP_002411438.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]