SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW014125-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW014125-PA
Domain Number 1 Region: 1232-1280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 2 Region: 752-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 3 Region: 1184-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000193
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 1387-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 5 Region: 1439-1487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 6 Region: 1339-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 7 Region: 1278-1330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 1490-1540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 925-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 10 Region: 875-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 11 Region: 687-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000607
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 12 Region: 815-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1538-1583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ISCW014125-PA
Domain Number - Region: 525-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000524
Family beta-mannanase CBM 0.065
Further Details:      
 
Domain Number - Region: 1962-2067
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00123
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 1721-1867
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00785
Family HBL-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW014125-PA
Sequence length 2084
Comment laminin beta 1 chain, putative|DS939152:141740:215798:-1|gene:ISCW014125
Sequence
MEDSVDWRTARGRHRAEDSRGGASRHSSEVDIQETREDRWPGPDGQRSSYSSRRYHQTPR
ESEEEESDDTRTNYTRRRYSVSAAGSRGHLSGTERGSRQRSEADLSTASRGSLDHYADRD
QWSGRSSSTTEKPEEDKTGATYVRQRYYSISSRKIEGVAESAADLSKQVGHETSLEHRRE
GGGGRQTEVGSSERVWTSGRRTGSGEDYGSSRWRQQHGSTADGRGGSDATTEGPYRSREW
DWRSRTRRPSTFDQDTRTGGDMSRTHVESSEVGGAHRTYQRYREGTSIRERHRVTSTGWR
NASSDLSGEPTAWEEDARRRYGTQEGIKGGHGSSEDGGRSSYSRTSYTRRTNGTSYRGGT
YYSRWAAGGRENVTTTGGSSLSYGASRTSGTYGGSEDSLSGYTRRGTTQAPTVIDRVDVV
VEERHPLSGSSRGSQPQACEESSCYPATGNLLIGREDKLSATSTCGLRAPEAFCIVSHLK
ERTKCFRCDSRSEGRNYHGIENIVFLEDVPHSFLFVRIGGKRHKGSWWQSENGVQGVSIR
LDLEAEFHFTHLIITFKTFRPAAMLIERSHDNGNSWRVYQYFAYDCADSFPGVPTGPRRN
ITDVTCETQYSGVEPSSGGEVIFRVLPPHIPIDNPHSPDVQNLLKMTNLRINFTRLHTLG
DNLLDSRQEIKQKYYYAVYDMVVRGSCSCYGHASRCIPEEDDHRGGRDDMVYGKCQCTHN
TKGLNCESCEELYNDQPWRPASEHDPNPCKQCNCNGHASRCHFDAAVWERSGRVSGGVCD
DCRDNTMGLNCEQCVPFYYKDPQRDPSDPYACQPCDCDPRGSLDEGVCDPQDDIQAGSVA
GRCHCKKNVESRRCDRCKRGHFNFQAANPDGCEPCSCHELGTAGDGCNVYTGECTCKRNV
IGRDCNQCLPEYWGLGNDEDGCKPCDCDPGGAYENSCDVVTGQCRCRPSVQGRRCDQPDT
GFFVGNMDYMVYEAELAKASPDCQVLVREPYAEREATWTGLGFMQVHEDSYLEFDVTDVP
TSMEYDIVFRYEPKLAHGWDEAIVTIDRQGPVDPSGPCANVISQDNRQVISFPASDRYVV
VAPPVCLEKGRRYKVRITFKQYDRIVDTPSASILIDSMVLLPHINAIPFFHGTPANEYRR
DEFERFRCGQAFYTVRRGSSSVPDICKKYLYSIGFYVYGGAHDCRCDAQGSHSSVCNTLG
GQCQCKANVVGRNCDRCAPGTYGFGPGGCRPCDCNGIGSLDNFCDAQTGQCKCRPNTYGR
QCDECQPGYWNYPNCQRCECHGHADTCDSRTGHCSHCRDFTSGPHCDRCETGFYGDPRYG
VDIPCRPCPCPGTIDSGVNHATSCDLDPRTGNVACHCSPGYVGERCDRCANNYYGEPNAP
GGECRRCECSGNTDDTQPGNCDSRTGVCLRCLYNTEGHHCERCKPGHYGDASRQQCLECV
CNMLGMDHTRGYCDAVTGQCPCLPNVEGRSCDRCAPNFWKIASGEGCEDCGCDPQGSYDL
KCNEFDGQCPCKPGHGGRQCNQCQDLHWGNPRVRCYQCECNVPGAATSQCHRNNGSCVCI
PGVAGDRCQECARGFTGRAPYCDSCGECFDNWDRIIQELKVHKSLDPDQTAQNTLESRRN
LTESQLKLDEVDQQAQNVTQRTFAANLALSDIHERAQKLGQDAKALRDNTTALQEANVEG
ALNITREAQKRSQLAVARARGAQDDVMKSEMTRRVTERMLESAASRYNDTYQENEAALRK
LQEQVADLEDQISDVNELVCYKRGTVERCDPVCGGAGCNSCGGLGCEDGSVTRANNTLAM
AQETNELLAKKESDARTLFAAVGKAQKESQRALDEAKKAFERAQTAKNQSEDVSSDLQDL
LDRIDKFLNEAGARPAEIRVLAEECTGLSISLEPEQIRELAREINQTIASLTDIDAILRE
TGPDLALAKELKARADLARDKANKILDTAKKVLQNLNDAEQAQDRAKQAIEKARDNIEAA
EKDLDQEAEELEEQYKRAMADLSGKSAASGDMKDRAEKLRERARKLAEGVNSKTTMLQGM
EDEFDDNERRLKDYSQILEQLNREMTGYLDLIERRSTHYRECQN
Download sequence
Identical sequences B7QHE0
ISCW014125-PA 6945.ISCW014125-PA XP_002414597.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]