SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016499-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016499-PA
Domain Number 1 Region: 88-337
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-31
Family YWTD domain 0.0002
Further Details:      
 
Domain Number 2 Region: 816-995
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000526
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 3 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000038
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 4 Region: 622-660
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000825
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 434-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 764-802
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 473-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 676-714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 526-564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 11 Region: 1005-1095
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000246
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 12 Region: 1201-1280
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000191
Family Fibronectin type III 0.0081
Further Details:      
 
Domain Number 13 Region: 1300-1387
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000209
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  ISCW016499-PA
Domain Number - Region: 730-755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 341-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016499-PA
Sequence length 1500
Comment low-density lipoprotein receptor, putative|DS649539:132617:293648:1|gene:ISCW016499
Sequence
DVGFREDEASRQCVREGEVDPYAVPTNCTEGAFYRRTKGYRRVSGDTCEGGRLLEYAPDE
ISCPLRNDEEFLLLGFNGSLSRVLLSEPQQSQWERLARHPRQAQDQWAAVLLDYDYHSQC
IFLYHQGIIFKWCPGQEQLLEPLDALHWQRVSDLALDWLSGVLYVADAGASRVEALAVEG
RGRHRRVLLAHDALAAPQSLAVHPTAGYLFVADWGEAPRVLRTFLDGSHPLVLASGPDVV
RPRGLCLDGGRLFWVDGGARSVVSAALDGTDRRSVLRGEAVLPNPVLVAVYKDWMYVADA
HRKQLLMASKQDGSGLEVLGRDLADISALKVYGPSSQQGSNGCSGAPNCSHFCFAVPGGG
HTCLCPAGFQVQKVGVGERCLCDRGEMLLADGTCGPARSTCSSRQFQCLKGQCIPLTWKC
DGEKDCVDGSDESLCGQSKCPASQFACANGQCIPSPWKCDTEDDCGDNSDESNCTFATCA
PEEFGCRNGRCIRRSLACDMEDDCGDASDEVNCTSESSSLGSMPRLFCCRPTEFKCSDQR
RCLPASWRCDGESDCQDGSDEAACSATTCAPWQLRCPSGRCIFPSWRCDGDRDCPDGSDE
ANCTATSTPGAPSSSSSTPPTSPHACGAERFQCGDGACILAGWQCDGVPDCLDGSDEAQC
GPGTSSPGTTAVSTAAPASCGPERFTCDSGKCIWNSWVCDGTHDCSQGEDERLCPGKWPF
CTWDLGRLACAGCVPLADVCNSHPDCADGSDEWGCDQNHDPWKQCSQDEFRCRGNNRCIP
ASRRCDGIGDCADSSDEASCKSELYSVHTLLVDSKHLNWTSVRIFWQPPGGNRSFEYLPT
VHVFCLRRRMLKDQSWRNESWTPGLSWVFARLSPGSRYRFGVYVRLARNHSHVSRPLEYV
VAATLSAAPPAPEDVVARQLVGRKVELSWRLPVSAALPPVDFFKVRFSPPYPAFVVTLAG
SVSSAVVDFPFQPGVTYTFTVASCARGQLESPPSAPAVLPFAKTDVLPALGHLRATPLGL
SAVALSWDALPGVDGYRVSWGLHTEDAYPLPWERADTPRAAFNLTWLPPGAKCTAKVFAF
KDEFHSPDEMVYFVTQGNGGLATQGQSQVESVLTASRRSWNIVSLLAEVSRLETEKCLAA
VANLPCFARDRPDRLGDTETPSYVVEQPLEPCRSYSFQVGLWEGSLGSASHLATEPATAR
TEFSPVAAPRAVSAALQEDHALVRWEASCPRLPRPTGYKVFVEEKQTGSRTVTAVPPTSS
AVLSATLGVHPGGAYSVRVSTDRPGALLSAPAEFAGPEMPAPLQLAVVPEMNGSLFVHWK
EPRLPPALAGHRVAYVVLLSRREDMAEAEAYNASQPPLTIPSVPGGHTYHVAVRMTDEHG
FQSALSAQLRVNFTLEELRANHVPSWLSTGPLSVGTGGLVGAVVGALAVLVALGLVLAFL
VVRHRRLQRSFVSFANTHYDTRSGATTFSTGADNGGLADDEDDDDPIIRGFSDDEPLVVA
Download sequence
Identical sequences B7P761
XP_002409615.1.51680 6945.ISCW016499-PA ISCW016499-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]