SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016509-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016509-PA
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000166
Family SPRY domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016509-PA
Sequence length 119
Comment conserved hypothetical protein|DS644582:132158:134367:-1|gene:ISCW016509
Sequence
LWGLGVATQKTDLNRVPLGQDLDSCVLTSDATVLCNREVLHKLQPTIQEGDVIGVSYDHL
ELNFYLNGADLHAPVTGVKGEVYPVLYVDDGAILDAVFTSFYHSPPPGFEQIMVEQSLL
Download sequence
Identical sequences B7P6C9
XP_002408524.1.51680 6945.ISCW016509-PA ISCW016509-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]