SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016869-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016869-PA
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-39
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 2 Region: 350-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 188-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 481-575
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-27
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 5 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000188
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 299-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000412
Family EGF-type module 0.0059
Further Details:      
 
Weak hits

Sequence:  ISCW016869-PA
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0353
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW016869-PA
Sequence length 609
Comment conserved hypothetical protein|DS667725:239316:273462:1|gene:ISCW016869
Sequence
MLLSTGYRLLIVYRTSSNQNGHIGFRAYYEAVCGGDVDQEEGVLQSPNYPDDYRPNKECV
WKITVPVNYQVALKFQSFEVENHDNCVYDYLEVRDGHDAGSPLLGKFCGYRTPDDQRSSS
NKMLVKFVSDSSVNKPGFSATFMKEYDECQKPDHGCDHECVNTLGGYRCECNIGYELHSD
GKKCEDACGGVIEASNGTITSPSFPDLYPSNKNCIWEIVASPQYRITLNFTHFDLEGNND
CEYDKVDIHSKMGDNTVRKHGLFCGSYLPPIITSEGNSLRIEFSSDNSVQKSGFAAVFLT
DKDECAHSNGGCQHICKNTVGSYSCACQNGFVLHPNRHDCKEGTCTHQISAPLGEINSPN
YPDSYPSRKDCAWLFTTTPGHRLKLIFNDFELEPHQECAYDHISLYDGDSTDAPTLGRFC
GAKVPHPILSTTNRMYMVFKSDASVQRKGFRAAHSTACGGRLLATGRTVEHLYSHAKYGD
QNYENKEDCDWLVEAEAGRVRLRFLTFELEHEQDCSYDYVELFDGYDDSAMPLGKFCGNQ
LPGEFTSSSGSLLLRFRSDDNINAKGFSAAYSAVDVGEDSATAAVPSVPEVRTVSSSHQR
DRKLRLHRH
Download sequence
Identical sequences B7P9W2
ISCW016869-PA XP_002405730.1.51680 6945.ISCW016869-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]