SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016923-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016923-PA
Domain Number 1 Region: 260-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000448
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 251-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000738
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ISCW016923-PA
Domain Number - Region: 400-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000215
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016923-PA
Sequence length 433
Comment neurogenic locus notch, putative|DS689861:77572:96507:1|gene:ISCW016923
Sequence
MAGRSEAVLLSLLLLLVPSQSRNTGLHPGSVVILNPTGAPLPTDIPVRDSSETPNVPAKD
QTGAGSTEASASSTFANVATEDSPGNVPTNLPADVPTSLPTKLATDVAKTEQYNLDKNET
GSFTSPVPESSPMSTYPPSTSKQQEIFNDQTTILSTDAVTVPPTDRSSTAAATDTSPPPE
DPKGPSCAAPDLPRWRPVPKTHRLRLSRANRRRLCGSALRARHVEERRRDTDLLVVGGTD
EDPGSTFKCYCLPGYGGDLCEFEYDECDSGPCSHGAQCEDLVAGFRCHCGPGYAGRACEI
KVDLCRPDPCPPPAQCVDRGNNYSCLCHPGYDVHLSGSEPGCSGQAAWLLNVSVHARECS
KSPQDSDTCSGGGACVLEPGQTSFSCRCCPGLRNRFCEERDGCFTRPCRNGGYCVDIAEG
LTGTMFQCLCLER
Download sequence
Identical sequences B7PDF9
ISCW016923-PA XP_002410793.1.51680 6945.ISCW016923-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]