SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW016925-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016925-PA
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000458
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW016925-PA
Sequence length 200
Comment hypothetical protein|DS689861:98420:106029:1|gene:ISCW016925
Sequence
MDGSDATAGRATGGDLRRVGPVPTGPCPPPGQCVDRGTTTAVSATPDTTNGGSCWPSLDS
FYCSCARGFSGDTCDTLLPFMAAAPHDKQTPGALPRRGTPDTAASGRSGPVDQLHNIYIA
AATLAGACLIVLAVVTVCHCRVHHSYRGCVRRLGRSCAQLKQHTLEDPDKSWLNLHGSAS
ELAAGALAAGLDSLRTPLIP
Download sequence
Identical sequences B7PDG1
ISCW016925-PA XP_002410795.1.51680 6945.ISCW016925-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]