SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017322-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017322-PA
Domain Number 1 Region: 2241-2449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-30
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 948-1072
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 1696-1807
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 424-530
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-28
Family Cadherin 0.00047
Further Details:      
 
Domain Number 5 Region: 111-214
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-28
Family Cadherin 0.00065
Further Details:      
 
Domain Number 6 Region: 210-333
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 7 Region: 532-642
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 8 Region: 1382-1493
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 636-739
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 10 Region: 1158-1291
Classification Level Classification E-value
Superfamily Cadherin-like 7e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 11 Region: 1481-1579
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-23
Family Cadherin 0.0021
Further Details:      
 
Domain Number 12 Region: 1064-1170
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 1800-1905
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 2461-2514,2542-2675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-22
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 15 Region: 10-109
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-22
Family Cadherin 0.0033
Further Details:      
 
Domain Number 16 Region: 735-850
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 17 Region: 317-426
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 18 Region: 1276-1378
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-21
Family Cadherin 0.0034
Further Details:      
 
Domain Number 19 Region: 1589-1694
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 20 Region: 874-960
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000385
Family Cadherin 0.0032
Further Details:      
 
Domain Number 21 Region: 2200-2243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000373
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 22 Region: 2157-2197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family EGF-type module 0.023
Further Details:      
 
Domain Number 23 Region: 2098-2156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000965
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  ISCW017322-PA
Domain Number - Region: 1918-2003
Classification Level Classification E-value
Superfamily Cadherin-like 0.00154
Family Cadherin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW017322-PA
Sequence length 3222
Comment protocadherin-16, putative|DS668046:1130794:1169644:1|gene:ISCW017322
Sequence
MVTVTVLDRNDSPPRFQNGPYTISLSEDAPVGSTVAVLQADDPDLEGSVRFSIAEGQSDA
GHFRIDPQTGALLLVEALDRELQAQHLFSVTATDGLQSTEALVSIEVTDTNDNLPLFGEA
AYSFDLWEDTQRGAQVGAVSAVDADLGLNRQVSYSVLSDWANDVFSLNPQTGVFTLTSHL
DYELYQHYVLVVQAQDSGTPSLSSTATVYVNVLDLNDNAPLFDPMSYSDEVLENVTVGSS
LLRVSATDLDSGDNGRIVYSIAEGDPGGQLAILANGTIVTRLPLDRERKSLYSLVVRATD
QAPEVHKRLSSSVQVTIVLKDVNDMVPEFVTPNVTSVQENAPANTIVMAVKAVDRDEGRN
SYVEYSVSPEHTFSLGPVDGLLRVRGLLDREQRASYELLVTARDRGHPVRVASQRLRVRL
LDENDNSPVFDPRQYSAAVSENSSVGASVLRVSATDQDEGASGQVRYSIIAGDPNHDFSV
GQDTGVLRVRRSLDYERRTRYLLTLQAEDCAGASSELRFDTATVTISVTDVNDNAPAFLD
SPYELHVVENAATPVVLLTLAAHDADQLPSGPIHYRLEDLGHGAFRINGTSGELSLERPL
DRELRDRYLLTVLAVDSGNPRQTGTGTVSVFVSDVNDNAPEFDRSRYVASLAENQPADHP
VTRITATDADVGRNARIRYSLHGEQGSRFSVDAESGLVRARVPMDREECERYELRLVAHD
DGLTVRHSATVELVVLVTDQNDNRPTFASANTSVVVPSGAEPGHFVLGARATDADSGPNG
QLVFHLSGPDVDKFQIQQDTGVIRLAHRLASSSPRDDSSYEIQVHATDQGRVPLVSSMTV
FVSTADARQFPKFRSSTPGMLTLAEGGGNGVAPLATLSATSPKKGPAGRITYRVASGGNA
FALHPDSGVLTVIRGDALDLEATPRLQLWLEARDADEPALSSAVRIDVQLTDVNDNVPEF
ERDVYNTSVREEQSAGQLVAQLHARDGDSGVNGKLRYELRPLPTSRDFDDLPFEIDAATG
ELRTTARLDRETVAHYRFLVEARDEGDPSLTGTATVLVSVSDKNDNPPRFTRLFSVNVTE
NAPLGAFVIQVTSSDRDAAENANATYSFTENPGERFAIDPLTGNVTVAGPLDRELRDEYL
LKVAAVDGSWKAETPLTVSLQDVNDNAPRFERMAYRFRLPELQSGGSFVGRVAATDADKT
GPNAAVSYSLRRPSDLFRVDPATGEVLSKQPLRYRRSPRGATSPENQHVLRVLATDHGKP
PLSSETTVYVSVVDANNHVPKFEQTTYFSPLPDNAAVGLSVVRVTARDDQDVGVNAELMY
SIFDGNGTDLLDIHQTSGWLTVAKPLPRQQGQMFALKVRATDQGVPPKSADTVVSVTITG
ENQFSPVFTALSYQIIIPENEPVHSELLTVSATDADSGLNGEVRYSIESGNTGDSFAMEP
HNGALTISAVLDYETVPEFRLNVSACDAAFHRKCASATLTVIVTDVNDCPPQFNATHFDA
YVAENEPPGTTVTQLSASDADSGRNRIVQYALVGGSSDFAVDPQSGVVTAQSSFDYEQTS
EYVLEVVASNPGSLQYSSCQLRVHVTGKNEFFPRFVQPVFQFAVSESTVVGTAVGRVLAT
DEDSGPEGDVYFLFVGSSNDRGFRIQPSTGVITVSRTLDREAQARVVLSVMAKNGGSIRG
NDTDEAQVVVSIQDGNDPPVFLQPLYEARISEAAPVGSPVLSVSAVDRDVRPNNHQFFYS
ILEGDPNKVFGVDSQTGLLHTAAPLDRESVPSYTLTLAAIDRGSPPQTGTATVRVTLDDV
NDNGPEFEPADLLGYVLEDEPPYTSVLTLAARDRDLAPNGAPFAYSLVGGARRNLFELDR
QTGVLRTTQRLDREATPSLQLLVEVQDSGNPPIRARHGLTVLLVDKNDSPSSPRSLTVLV
WVYHSVFAGGKIADVRPLDPDATGEYQCRLESRESVFSIVSQCDLHASRLLSPSNYSFTV
RGNDGYHQDVTSTVNVQFRVFDNATVENSVSLRVVNQSAGDFLGSSYDRFLGLLRQVLEG
MGSPIVYSMADVKGQLQLTLAVRKSSGILVSPDKVSQRLEARRDTLQSSLAKTIVVGYEP
CASSPCRHGGTCSSRLDFQTSLSILDSAQLVFASPGATRSFACSCPVGFSGLQCQDQLDP
CSPSPCSEGSTCRIDAATTVGFQCLCPEDREGERCERPRRNSCASAPCKNGGSCREAPAG
SFFCLCRLGFKGSLCEQAADGCYHCLCEPNFFGRHCEKSTFGFEPYSYMAFPSLKPSTND
ISVVFATNRRHALLAYNFGAQNGGRSDFVALEIADGRPTFSFGGSRTAVAKVALDRDVAD
GNWHRVTVIRNGRVASLSVVSCQDHGELCEECSHANSSCSLSVTGQAGTLSLSSQPLYIG
GLPSVEPLLERPSQVWADDFVGCVHSVAVDGQPLALERPLRQQYVARTCGRRGDPCATGG
CRGANACRDLWSAAGCTCPGGMLVAQDCGQALEPYWLSGGSFLELVPQEKHRREALVQQR
RRQQQQQQPQPQRASRDLPPSKALSLRLRTLAQDGLLLHVATERDHTRLQLAEGHLEYLS
QSGQQEPVQWRHPARVSDGHWHQVVLSRTLETGGGAVSLTVDDQQRRVPTDASLHDFLDP
FLTSFTIGGRWEQNAVSAESLPGSLQGCVQQIAVNGELQSVNASQGYFRLVARGAVGRSC
SQEALRLDVAADPLGVGIILVIAFFVVLILVILVSLLVFRRCKLKRHKAPTPIKPNGNAL
INQITEATRGSVHTEPGYADGATPSAPEEHLRNPPSAQDLVPPKRAKERDIGSDNHLPRT
PQRPDIIEREVMHASSPLAASRCAEQSVYGAAAEPEHYDLENASSIAPSDIDIVYHYRVF
RDGSQLRKLHHNKGLHKHPGPHRHSPASPTARQSPRQQLLLRPAARDSPSALKMHHSTPL
ARLSPSSELSRQTPRILTLQDISGKPLQTALLASAHPGNGAKPFKDALTNSERSLNSPVS
QLSRSTGSLPSAKLKQACAAPAAESRHAQPLAGLGLTAEEIECLNARPRNCSLVSTLDAV
SSSGSEGTKGKLSQLLDDRPAALLDAATGHDSSSDESGNDSFTCSEFEYDNGYEKAHRDF
APGNMIFSKLAEEDNENDEDSSKTYDGFDSFRGSLSTLVASDDDLSHLSYKPPSGAVLGW
DCLLNWGPNFENLVGVFKDIADLPDTVSPLTPGHPKPSEEYV
Download sequence
Identical sequences B7P9Y8
XP_002405854.1.51680 6945.ISCW017322-PA ISCW017322-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]