SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW017565-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW017565-PA
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.73e-19
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 2 Region: 263-417
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 157-219
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000868
Family VWC domain 0.0044
Further Details:      
 
Domain Number 4 Region: 569-639
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000199
Family VWC domain 0.01
Further Details:      
 
Domain Number 5 Region: 484-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000182
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 405-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ISCW017565-PA
Domain Number - Region: 651-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.000534
Family Fibronectin type I module 0.079
Further Details:      
 
Domain Number - Region: 441-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000901
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW017565-PA
Sequence length 695
Comment protein kinase C-binding protein NELL1, putative|DS690851:46942:79747:-1|gene:ISCW017565
Sequence
RFFELQSSGRKDEIRLHYSHANGELVETFPYRLADNTWHRLAVALSGDSVEVFVDCNRIY
SRVIKKLDLNTANRNLSLWLGQRNLKHYYFNGILQDVKVVFRPHGFLLQCPQLDTECPTC
GQFQELQQSVNQLKTYIINLTQRLIEAEERIASVEQCECQKSCRVNGTVRPDGSIWKQDC
DICTCAQGKVECRPISCPTPPCKHPVLQPGECCPSCLKRCFLKQVLYDHGEQVTQKLHMI
LQILQDGQMTCRRIDQKTCPALTCPESQRFSVPGECCMFCPGVDYCGRGHDCDVNATCIN
LQTKYACQCNTGYKGNGRSCEDVDECLKEGGFDGHHCQESTRCVNTPGAYTCECLPGFRR
VDAYNCEEHDECASNEHNCHKDARCINTMGSYKCECLPGYRGDGITCEPICNQTCLNGGK
CAAPNVCNCRRGYKGSSCEIDVNECSENVHQCHKNSNCINMPGWYYCESDAMVSFSCAHF
LVADIDECSLGTHTCHSTATCINLEGSFQCICADNATCSFNCDHLGMERINGEVWPIGPG
SCTTCACRNGVVDCRKARCDCSDPRTDLECCPQCDRSSFCEHQEAPIKFANGERWIYQCQ
ICECLFGEVDCWSMECPHVACSNPVQRAGDCCPYCEDDPCDTGANGTRSPRGCTYMGRLY
QTGERVPLAQDPCTSCKCSDGQLCCMYSTNCLGNA
Download sequence
Identical sequences B7PDN5
ISCW017565-PA XP_002410973.1.51680 6945.ISCW017565-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]