SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018236-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW018236-PA
Domain Number - Region: 19-76
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0133
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018236-PA
Sequence length 81
Comment conserved hypothetical protein|DS714433:167779:168848:-1|gene:ISCW018236
Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKECTIQEKD
Download sequence
Identical sequences B7PHP4 G1MB16 G1RZV6
ENSNLEP00000018783 ENSNLEP00000018783 XP_002403364.1.51680 ENSAMEP00000016543 ENSAMEP00000016543 ISCW018236-PA 6945.ISCW018236-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]