SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019522-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019522-PA
Domain Number 1 Region: 568-763
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-74
Family Sec7 domain 0.00000295
Further Details:      
 
Domain Number 2 Region: 85-157,336-519,808-850,1045-1418
Classification Level Classification E-value
Superfamily ARM repeat 1.06e-28
Family MIF4G domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW019522-PA
Sequence length 1645
Comment brefeldin A-inhibited guanine nucleotide-exchange protein, putative|DS802112:63114:138449:-1|gene:ISCW019522
Sequence
MRTGSNTGEMFITRALEKILNDREIRRSYHSQLRKACEVALGESVYAASVFRIRLSMQET
SSALPLPKGQAGLEAERYLMPFELACQSKSPRIVVTALDCIQKLIAYGHLTGHLPDPTNP
SKLLIDRIVETVCGCFQGPTTDDGVQLQIIKALLTVVTSQSCEVHEGSVLQPVRTCYNIY
LASRNLVNQTTAIATLTQMLNVIFARMEACCGPEAADGALPHTVTQDTAADADSVGGGSA
TLDDRGESSQEVVATVLQEILNRVVSGSGDGPSPATPAGPTLARASSQESMAASCEGGSA
VQAHFAHVVQKDAFLVFRSLCKLSMKPLPEGQPDPRSHELRSKVLSLQLLLLILQNAGPV
FRTNDMFVNAIKQYLCVALSKNGVSSVPEVFEISVTIFLALLQNFKTHLKMQIEVFFKEI
FLNILETSSSSFGHKWKVIQVLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIA
QGRQALELGATAHQEKSMRVKGLECLVSVLKCMLEWSKDLYANPGSAAAAGAGSGGGSVG
VSGSEDRSLVSHGGSSNSLNSVSSSNIPEQLEVLKQQKEIMEQGIDLFNRKPKRGLQFLQ
EHGLVGPQPWDVAEFFHIDERLDKNQIGDFLGENEKLNKEVMCAYVDQMDFAEKDFVSAL
RGFLEGFRLPGEAQKIDRLMEKFAARYCETNPNNGLFASADTAYVLAYSIIMLTTDLHSP
QVKTKMTKEQYIRMNRGINDSKDLPEDYLSQIYDEIAGNEIKMKTTSSKLAGKQSESPFA
HSYEKKRRLLYNMEMEQMARTAKALMESVSHVQASFTCAKHLEHVRPMFKLAWTPFLAAF
SVGLQDCDDPEIAALCLDGIRCAIRIACIFHMTLERNAYVQALARFTLLTANSPITEMKS
KNIDTIKTLITVAHLDGNYLGKSWLDILRCISQLELAQLIGTGVKPRYLGSGGAGQGSSV
FGGGSGGHGGGSSQDSVLDPMECEQTKCEEYDMTCMLKLLPLLPAQVSLEELANPSHPRM
FSLQKIVEISYYNMGRIRLQWSRIWEVLGEHFNRVGCSPSEDVAFFALDSLRQLSMKFIE
KGEFANFRFQKDFLRPFEHIVKRNRSPTIRDMVVRCVAQMVNSQAANIKSGWKNIFSVFH
LAASDRDEGIVELAFQTTGRIVTQTYGRHFLALVDSFQDAVKCLSEFACNACFPDTSMES
IRLIRHCAKYVAEQPQTFRDHNMEDQTVPEEDRVWVRGWFPILFELSCIVNRCKLDIRTR
ALTVMFEVVKTYGASFRPHWWQDLFQIIFRIFDNMKLPERHNEKAEWMTTTCNHALYAIV
DVFTQYYDVLGNLLLDDLFVQLHWCVQQDNKQLARSGTNCLENLVISNGTKFSTETWDKT
CQCMLDIFKTTLPEMLLTWTPSKEGGNHENDEVQFNSLKVKCVVQLELIQTIDNIVFFPA
TSRKEDAENLAAAQEQLLLHQLGRSLSLDQQQEEQGMYGFLSSGQLLLLVDCLLESHRFA
KAFNAHGEQRNLLWRAGFRGNVKPNLLTQEAQSLACVLRILFRMYRDEGRQDAWHTVQDR
LIGVCREALQYYLSLATESHRESWDSLLLLFLTRVQRLDDERATHASVYYPYLCELTCMD
EKPAIRAVLRKFFLRVGTAFNVSHH
Download sequence
Identical sequences B7PVS0
6945.ISCW019522-PA ISCW019522-PA XP_002408596.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]