SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019817-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019817-PA
Domain Number 1 Region: 306-560
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-47
Family Kelch motif 0.0024
Further Details:      
 
Domain Number 2 Region: 53-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 967-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ISCW019817-PA
Domain Number - Region: 176-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW019817-PA
Sequence length 1329
Comment attractin, putative|DS785783:50305:166656:1|gene:ISCW019817
Sequence
CWSMVFCALLVCLLQLTAAERTLCGDVECWYGDCSGDGRCLCYPGWQGPGCERCAGRVSL
ADPSGVISTGVGNYSKDMKCTWLVESGLPNATIRLEFSHFETECGWDHLYVYDGDSMFAP
MIVFTTGLLLSKASSSRLPEIVTHSGSAFVHFYSDAVYNMSGFNLTYRVDGCPRGCSGRG
TCVGGVCHCPSGWTGEDCGRAPCRDCVCDGGNSFLRFGTTLCWLGLMSKWKDCGHLAGDC
SVVEGGALYELVPTRGWVQGRALHGALVVGDSMWVVGGEGLTRLDQQIARYDFGRHEWET
VQPSTPSAPLHRYGHSLVLYRSSLYLFGGTLRDGRTANDLWRWDPSGRSWSQLSPTQPEC
QNELCPPLTATGHSAVVVDATMLVFFGHNPDYGYLNVVQEYAFGSDKWEIVQTRGAIVKG
GYGHSSVYDPVERQVLVFGGYHSQTTTGVVVDCLYAYRPSERLWTLLAPSSSHRYLHSAV
LLHRTMLVFGGNTHNDTAFSTGDKCFSADLLAYDLECDSWQTLPGPSSMQLERFGHSAVV
YNQSLYIFGGFNGQMLASLVKYTPGACRGLSTAEECSASQAEVQCAWIAGSCQPRSDRGP
DRKGCPRKSAANLTVLCEKQTSCPSCLQNNYSCVWCGTACAHKHCPKGSKVGLPSCCLCR
SSSPQWTGVCEELILPPPLRSLPLYRTCAASPLACVGQEGREPAQACQETGLRTGRWMAS
KRRCLRGRLVNGTQGLVDARENQTDVDQCQQSESSNCDKLHNCHACHTEFHCGWQNDHRC
YTFVRESAPGMIPGFYLGVSEWLERKKSVGTGWVTWAGVGAGNKTEKAVLSDNYRVKCDN
SCSSRPTCKACVLGSCMWCISQQRCLETNAYAATFPLAQCTEWTTTKCSALSCEDFQTCS
RCQEHERCGWCDDGSQTGKGRCLDGAASGPLAGPCPAHNWHFTGCPGEPFPTSKLLSGQA
TNAMTQCQCNGHSTCNGSSECLQPCLHRTQGLHCEHCISGYHGNPANGGNCTPCFCNNHG
SLCHRETGKCNCTTKGIIGPNCDRQNHYVGSPQEEGGTCFYNLSIDFQYTFNLSSEDYYR
NINFMNVPIKVGNDVEFTISCSGRAYVNISIGSGGQPPSHADGDTEPMLLDSRRCDNIKL
PFYDEKHNFGSQNTTFFVYVFNFTTPFVLQISFSQHRALDLLQFFITFSSCFLSLLIIAA
ILWKIKQKYDLYRRRQQLFVEMEQMASRPFAGVTLELDGELDGWSKQLQDGVKQGHPTPV
ALEPCASGKAAVLSLIVRLPTGGQEHTATGQSGLAIASALVSLGTLCKTIKEDGKSDCWK
PSSHPGTCI
Download sequence
Identical sequences A0A1S4LVV4 B7PTH5
ISCW019817-PA 6945.ISCW019817-PA XP_002404410.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]