SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020415-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020415-PA
Domain Number 1 Region: 563-675
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-36
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 452-559
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-35
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 1026-1140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-35
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 4 Region: 911-1020
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 5 Region: 677-789
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 6 Region: 793-904
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-29
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 7 Region: 323-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 8 Region: 1141-1201
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-18
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 10-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000143
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 47-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000429
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 285-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000575
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ISCW020415-PA
Domain Number - Region: 103-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000118
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 191-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00233
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 262-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0857
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW020415-PA
Sequence length 1203
Comment cubilin, putative|DS825043:154712:235042:1|gene:ISCW020415
Sequence
MRRLQNNLRRDACSSNPCGHGGTCVSRYNGYLCLCPAGWQGGRCEEDVDECAHLAGSDLG
CQNGATCVNTPGAYRCQCTQGFFGAHCTERQDDCSLASASALCDHGTCIGLPRVAGQPGF
RCLCDQGWTTGPGQLSCSQDVNECASGRHFCSKNPPVACLNFPGGFGCGPCPQAIVTSSF
FFCSQRALRKCKRRMTTSSITVDCFNTIGSRSCGPCPPGYVGDGVTCTYLGLCNVDNGGC
SPLATCIEQRPWSPPGFLAQAFGNSFQCVCEAGFSGRLCDQAQGGCTSDPCQNNGTCHND
GPTGVACTCTPEWTGPLCEEPRQACGGQLYGTNGTLRYPETGEAYTHKRNCIWVLRTTRG
KVLNVSFSEFHLEDGGSGCGFDFLEIHDGPTSMSRALGRYCGTTLRGKNLASTHDSLFLW
FKTDSSVTGVGFALDWITTDPVCGRDFPVADVGSVSSPGYPGHYPSSRDCMWTVAVPPGK
RIQIHLATVQMEHHQNCSYDFLKVYDGASERDQLLGTFCGSGAPGPRPVLTSSHLALLHF
HSDDSSTDVGFHATYASVPGVPGCGGVLSRAKGRFTSPSYPSPYENGLLCEWEIRAAPEE
RLQITFDSFTLEQHSACRWDALEVYDGRDDNAPLLGRFCGSALPPAVLSHGSVLYVRFRT
DQSTQLQGFSASYEAVCGGHWTSLRGELSSPRYPEPYPARRLCNYTIELPPGNLVQLDWQ
HMDIENDGHCAYDYVEVWEPWRNGSERRRGRYCGSVPPDPVTSAYNRLSLRFHSDHSVQH
RGFLANYSALDIGCGGVLSEPGRLQSPASESAQSGYRHESHCRWLLKAPPGHTVRLSFSQ
FALEESTNCSYDYVEIHDSSDERVGRYCGGRAPPTITSTGELLHVLFRTDDSVARDGFLA
HFEFLDGRTACGGEFFLSQGVVRSPLFPRHYPADRDCVWLLHVPDGRQIRLNFTHFDLEN
STICAFDFLELRNGAQETSPLAGTFCGREAPVGFVSDSNSLRLRFVSDSSMFGQGFQVFY
DSALTGCGGVLTGSSGSLMSPNYPRPYGHNAECRWLIRVSQGSRIALTVVDMDIEEQPDC
GYDALEVFDGDSARGERKARLCNLQQRPGHLTSSGSTIFLRFRSDASGAGRGFHVVYTAM
CSSVIRHQPRGVIESPNFPAPYPSNANCTWTIEALSGHNISLAFSTLEIEHEANCSYDYL
EAL
Download sequence
Identical sequences B7PZ82
6945.ISCW020415-PA XP_002404947.1.51680 ISCW020415-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]