SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021545-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021545-PA
Domain Number 1 Region: 1130-1261
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.67e-21
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 2 Region: 4-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 1470-1603
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.77e-18
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 1001-1130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 406-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 729-803
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.71e-16
Family TB module/8-cys domain 0.00018
Further Details:      
 
Domain Number 7 Region: 1294-1428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-16
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 8 Region: 267-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 1564-1691
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000282
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 10 Region: 1411-1479
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000746
Family TB module/8-cys domain 0.00072
Further Details:      
 
Domain Number 11 Region: 203-275
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000824
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 12 Region: 523-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 772-901
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 14 Region: 687-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000331
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 15 Region: 893-1006
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 122-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 1651-1768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 652-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000259
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 1250-1283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000816
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW021545-PA
Sequence length 1934
Comment fibrillin-1, putative|DS883946:646:95074:1|gene:ISCW021545
Sequence
IDECAENNYCSLGKCINTKGSFRCICPPGFDATPDGTDCSDRDECKESGMCSHGRCVNMA
GSYKCECDRGFTLSTSGRACVDIDECLDNNRICLKGGVCENVPGSYRCVCNNGYVLSQDG
QFCVDVNECADTNMCQNGVCINMDGSVKCRCNPGFKQSFDGHHCIDMDECYELENTCGSG
RCENTVGSFRCLCDDGFSIGPGGRSCIDTRRDYCYTMHQNGVCGQPSTMLVKKSACCCAA
HNGGQVAWGAQCKPCPTPGSPEYSRLCPNGTGTGPSGEDINECWVFPQMCPNGACENLKG
SYRCICNPGYQVDNTGKVCSDLNECLYFPGLCQNGRCQNSIGSFTCTCNQGFALDQEGIN
CTDIDECSTTSGICSNGICENTMGTYQCFCNQGYRQNNQQTSCEDIDECEYNRGNCRSLC
TNTPGSYYCACEPGYALLPDGVSCTDVDECKTDPDVCNGGKCRNLPGDYVCTCTEGLLPD
PDGKGCIDYDECEANPRLCTHGRCENTLGSYICRCQIGYSVKEGQIHCTDDDECTNGSND
CHEFADCTNLDGSYRCTCRDGFDGDGVTCKDVNECLRENGGCDTDADCINTDGSFKCVCD
EGFEGNGFHCRDKDECSITTAICENGQCVNYAGSYRCECDMGFSQTDNMQACVDINECSV
FSNICVYDCINTDGSFKCVCDEGFEGNGFHCRDIDECSSPASCQHGTCVNTLGSYVCQCP
PNYSLAPSGTGCVDSRQDLCYKDVRGNFHGRGICLSPIDTPMSQATCCCTVGAAWGRGCD
ICPAKNTTEYKELCAGGPGFRPNIETVELEDIDECAELDGVCRDGRCSNTFGSFLCVCPD
GYTLDDSQRACIDVNECDQYPDVCGPGTCFNSDGSFRCHCPPDYVVVPGGKSCVAQYKAL
CSSTPLGTIMNPITHVIDDVDECQGMVCQEGRCTNTIGSFVCQCYDGFRYDPNLMTCEDI
NECQENPGICSGTAKCVNERGSYECRCPDGYESSSSHRGCDDVDECKQPHICQNGVCINL
DGGFQCTCNPGYYSTPAGDTCIDFDECARSPGICSNGMCENVPGSYRCICNPGFQLSPDN
DCYDVDECRTQYRICHNGRCRNTIGSFQCHCQAGYQLSPDGRSCVDVNECETEVCHKGSC
RNSEGSFECSCPEGYQLSHDGRECVDVDECLSISQLCLGGVCENTEGGFRCSCPPGFKLS
ADARGCIDINECMMSPDICQNGECINTDGSYRCQCEPGFKLDPSGHVCLDEDECAEKRTI
CGNGTCSNTLGGFECHCGEGFTPGIRNVCEDLNECVMGIDDCAFRCLNTAGSFRCTCPYG
YTLAPDGKHCQDLDECASGDHGCRYACKNLVGTFQCICPDGMRSTGRGDDCTDINECQEN
PDICQNGECINTHGGYRCRCYHGFEPSSNGKQCLDNRLGTCYQTASSCPNSNGQLGLTSR
DECCCSVGIVWGSHCEACPQRNTQEFNSLCELGTGFNKDGQDVNECETLPHLCNNGRCIN
TQGSYRCLCNRGYKTDPTGTRCVDVNECELPVSPCKSKCLNTEGSYICSCDDGYVLAEDK
VSCKDVDECATDRHNCEHSCINTQGSYRCSCKDGYNVLESQCLDVNECREQPHLCAPSGT
CTNMPGSYRCNCPRGYITDASGQSCKDTDECADPSRCPHGCENLEGSYRCTCPPGFKQHP
YWNQCLDDNECLSQPCGTANCVNTVGSYSCNCPNGFSFDEIMTSCVGGSGCSNSPCLFEC
MPTGSGGFLCSCPEGYQRIGQGHCLSTHPESSTLGPGKGVPGDVGIPTYDIGNAGPQDPD
KVISTEGCYSCKLNGGSETEEQTTAHKRRHLKSRWDVIKVTLPLRQAQVHQNILDIRPAY
KHLRDDKNYHVLHGVDRNRFSVVSSDGGVTLQLAESIKKAGLYKVNIGSRSPSEEEAENQ
SRAFRLRVHLAVTE
Download sequence
Identical sequences B7Q8G4
ISCW021545-PA 6945.ISCW021545-PA XP_002412357.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]