SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021962-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021962-PA
Domain Number 1 Region: 145-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000967
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 114-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000723
Family EGF-type module 0.022
Further Details:      
 
Domain Number 3 Region: 187-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000081
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ISCW021962-PA
Domain Number - Region: 82-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000723
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021962-PA
Sequence length 222
Comment conserved hypothetical protein|DS928434:20127:35623:1|gene:ISCW021962
Sequence
MEIFAILDGVVLPYILDPNFEKYLPVIPSEVNSVNFTWKAGENKNYYYDFDVLESFDSSV
LANPLLSVASKGKVPRKPKALCYPQCMNGGTCVSPGICDCAVGYQGPHCEGGICAEKCLN
GGKCVQKDTCSCRRGYYGPRCEYSKCSIPCLNGGRCVGVNQCRCTRSFVGPQCAHRIDSS
AAATVHKDHCQRRCVHGVCVRSNRCLCDEGFYGRRCARRRHT
Download sequence
Identical sequences B7QFX1
ISCW021962-PA XP_002401034.1.51680 6945.ISCW021962-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]