SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022022-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022022-PA
Domain Number 1 Region: 189-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 6-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000342
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 123-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000034
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 4 Region: 314-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000437
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 87-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 323-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000549
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 45-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 165-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000692
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW022022-PA
Sequence length 432
Comment conserved hypothetical protein|DS926387:649068:656481:1|gene:ISCW022022
Sequence
GQFCETDMNECDSMPCYNGGTCLDHPQGYTCKCAPGYSGLQCQLEKSDCLNNTCPDRAMC
QDMPGIGTVNCLCRSGYEGPTCNITVNPCTVGDSPCANGGLCIPLLQGRYKCQCPPGWAG
PMCQENVDDCAENPCLLGANCTDLVNDFVCDCPPGFTGKRCHQKVDLCGVDPCVHGVCVD
RLFYSECLCQPGWEGQTCERNVDDCLSSPCANNGVCIDAVDGFRCQCDTGYTGSRCQHTI
DDCESSPCQNGGSCFDQIEGFICQCRPGYVGLQCEAEVNINECESNPCLNDGKCTDSING
YKCYCPPGWTGERCEVDVGGCSSDPCLNDARCIDLFEDYFCVCPSGTDGKRCQTSPQRCI
GNPCTHGGTCRDFGSGLNCTCPAGYSGHGCQYEHKACADVCRNGATCHEVGGTYHCTCAP
GFTGPHCEDDIQ
Download sequence
Identical sequences B7QFM9
XP_002414343.1.51680 ISCW022022-PA 6945.ISCW022022-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]