SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023971-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023971-PA
Domain Number 1 Region: 283-511
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-50
Family YWTD domain 0.00000278
Further Details:      
 
Domain Number 2 Region: 3-238
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-45
Family YWTD domain 0.00000385
Further Details:      
 
Domain Number 3 Region: 580-770
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-38
Family YWTD domain 0.0000329
Further Details:      
 
Domain Number 4 Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023971-PA
Sequence length 776
Comment low-density lipoprotein receptor, putative|DS979495:553113:575292:-1|gene:ISCW023971
Sequence
IVGNLEDAAALDFIYDLGMVFWTDIGLEVIKGRAVNGSGAEITVASMGVVSPDGLACDWI
GRKLYWTDSDTNRIEVSQLDGLHRKVLFWKDLDQPRAITLVPTEGLMFWTDWGETPKIER
ASMDGNPGTRKIIVREDIFWPNGLTVDYGAKRIYWADAKLRFISSMDYEGAGRAVVIQGS
LPHPFALTVHGDTLYWTDWQAKAVQSCSKLTGTHKRIVLSGDLEPMDIHAYGPLRQPTGH
GRTSMDPVSPGLFSFPTVASSGYPVPFVSHRCDPNGAGAREILLLARRTDLRRISLDMPD
YTDVVLPLRGIKHAIAIDYDPVEGRIYWTDDEVCVIQRAYLNGSNQEPVVTSEVQHPDGM
AVDWIARNLYWTDTGTDRIEVARLNGTSRKVLISEDLGEPRAIVLDPPKGYMYWTDWGNA
PKIERAALDGGQRRVLVSTGLGWPNGLAIDTRAGKLYWADARMDRIETASVDGTGRKVLV
SDQLPHVFGFTLLGEYMYWTDWQGRSIERIWVSWVSNGAGRPRLSPSTLHASAGTNPCAV
SNGGCSHLCLNRPNGEAPACACPTGLELREDLQTCTATEAFLLYVQREDIWRISLQSRRK
DHVPLSGVMEAAALDYDVSDGRIYWTDTGLKRISRAFLNGSQPQTLVEFGLDYPEGMAVD
WVAHNLYWVDMGLKRLEVSRLDGSSRRVLLWKGLDDPRSLALDPSHKFMYWSDWGKTPRI
ERAALDGSQRVRLITKIARANSLTIDHVDRRLYWTASDSNLIESSDMSGTPCFFFA
Download sequence
Identical sequences B7QNN3
XP_002416538.1.51680 ISCW023971-PA 6945.ISCW023971-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]