SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024323-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW024323-PA
Domain Number 1 Region: 99-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000879
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 63-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.061
Further Details:      
 
Weak hits

Sequence:  ISCW024323-PA
Domain Number - Region: 157-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000435
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW024323-PA
Sequence length 188
Comment laminin subunit beta-1, putative|DS755473:221:1510:-1|gene:ISCW024323
Sequence
GEFRQLSGRKVTREQLMMALVNLDGLYIRGSYFQPSLDVRLSNVALDTALTSYVPNAAQA
LTVEQCHCPPNYKGTSCEECAAGYYRSATGPYLGFCVPCQCNGHADTCDVVTGKCHSCQD
NTFGDHCEQCLPGYHGDATRGNHDDCLICACPIPLPSNNFADSCEVSPSGQEISCNCKKG
YYGPRCDV
Download sequence
Identical sequences B7PP03
XP_002435495.1.51680 6945.ISCW024323-PA ISCW024323-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]