SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|103899|fgenesh2_pg.C_Chr_13000272 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|MicpuN2|103899|fgenesh2_pg.C_Chr_13000272
Domain Number - Region: 551-595
Classification Level Classification E-value
Superfamily SIS domain 0.0528
Family mono-SIS domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|103899|fgenesh2_pg.C_Chr_13000272
Sequence length 890
Sequence
MGATADDVPATERVCKHAVDIESLDARGILAALGASDKELYASESTCAQPALSHPKILND
VGECADVVSELLRRSLEDAKATIAAREPAAADGGVKPSDADGEIRPATMAENDANSTGDE
TRLDEFDFDRFASKEGAARATEEAPTTADPRPRTDPPEGGRRADDDANDDDDAMELLDAM
LKEEDGEDGEDVTLPPAPDVPPTAAVFVVGCGYAGRVAFLAATHANHVAVMRGFQPIFHP
ILPGGTSQLCDVGAPETAEDDHRAAIDDFDAALARAGGDTIVDAAIVGVAHGFRERYVAS
AVDRAMRDPKRRFSVFLVGYCAGKHASDEGPGSVARAAVEGGATGEPGGPPPGTPHGAPP
TFRDVVWRLEPDLGGLLTEHPWNISPFKDGYGPIDAAEGKWERRMPMRVRKRKIINPVVG
AECVHACDALKCGTATKIILDAAFSTGILMAEDDEREREWENVDPKDADADPDADPANLV
ERPGPYPIAWEASECALEMVATYLMSASGVTQHFYRSALGKSKSTSTSKSKSKKEDALTE
EGDERGEDEAKSSFDAGVVSVVERAASAVASGGSVHFVGHGGVGAMALIAVPDAITAFGA
AQRDFHAHLGTKGGWGALDPAFDDEHGGGSPRPPPGGAREISREHFVDATLPKLRANDLV
VQLAAGHTPCAVVMTNDLTYHDVAERFPSAGIAAVRWPEVAEAAKARGVGVAVVVAPGYE
CAQLCPPAPERSVLRAVWCARLAEVHVKHAIDAIVAGCGVLLGRTSHGGMPICSLVQNER
TLARATRVVAVAAGCGEDRAKMAVVRSVLGDEFDPRPGGDRVPRAEVLCKRARAAAAAEG
AGVVPVAVLLAGEVCATAAEAREAVTEAASDGGGCVTGGGVRGVLSRYSR
Download sequence
Identical sequences C1EFE6
jgi|MicpuN2|103899|fgenesh2_pg.C_Chr_13000272 XP_002505584.1.63511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]