SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|52109|est_orfs.Chr_03_1980_3201575:1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|52109|est_orfs.Chr_03_1980_3201575:1
Domain Number 1 Region: 383-454
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 120-163,273-301
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000531
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|52109|est_orfs.Chr_03_1980_3201575:1
Sequence length 699
Sequence
MGPKKGGTKKAAQTAKTAKAAGKKPPGRPRKVKEPVQEEEPAEDAPADDDQADDEKGSGR
SEPADDATPMDDADPVEAKATDDDAPAAKEDPPAADGEADDKTKAGGDEPHPTIGTVPDE
TVRSCLRIVVPSDKAGYVIGPRGKIVAHARKESGCGFHLQETSKTHAARVAVVTCADKRS
EPGSFQGVRGVEMVYLRSTEEMIPKDADLNDPPMGARPEQTQTQRVHIIVAASQMEKADV
SELATGAGADCEKVVALEKGSKDCEALHAALGSIVFPTDRFVEIVGTDAAVRAALTVLMM
RLDYRANPPIASEDPLLLIDAPDVKEGYFREKKEKDRLQRARDSHGAGRDGRGRHHPYGG
GGRGGGGGGNYDRGPPPRGSGGGGGGDEIRMTFGIDAQFAGGVIGKMGSNVGQIRRESGA
RITVHESHGKFRVVAIEGTDRQCHDAKHLVQQAVTKQGGGPVGAHRIEPSTGRGGRDGRG
RDTAVHRDPVVRGGAAGGGSYYDQYDRRGRGDRGYDRGGYDRGGYDRGGYDRGGYDRGGY
DRGGGYGRDAYYDAQGPGSAYADRSSYPDRGGYGGGGRDAPHYDERDTHRQWLGGDRDGG
YNNYQGVQQSHQQQQGWAGQNQQWGGSNQQQSYNNQQPSYHGQQQSYDQGGGYNNNQQGG
GNDYYNRGQQQSGYGNQGGQYDQQGDYYSRGQQWGGSRY
Download sequence
Identical sequences C1E0S3
jgi|MicpuN2|52109|est_orfs.Chr_03_1980_3201575:1 XP_002500348.1.63511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]