SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|99702|fgenesh2_pg.C_Chr_03000483 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|99702|fgenesh2_pg.C_Chr_03000483
Domain Number 1 Region: 706-797
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 519-610
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000361
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|99702|fgenesh2_pg.C_Chr_03000483
Sequence length 1138
Sequence
MTAQPRGYRSPYSPEGLDKTRGGARVDDDDDEVYPRETRAATAPARDPPVNLDPRQFPTL
HAARAAEPKRRLRADPIASALERDAAAADDDDARQPGSGGGVTVVHAKVVSSPDAGNAWA
KPPPLVRSPERAPARAGPAARGPSAGDVCADRPRHPAVASRVAAPAPVHREDEKSAGNEA
AETPRSAAVNERVPREEESAPPLAAAADDDRPAPIPAPLERGPSHRRSRSRRKRREATPA
VPASPPATATTTTTTTTTAKKFQTAAEALAKGVGVCDDGLERPGPAGVHVGSDTDDDEGI
DHPTTPSPAPVLVRAGAEAKRSRPASPAKAVDVSDDTTASAPTTAGDDTSREEPSTIGAV
DESTTREEEEEGDETKEEVKEAIEVKERIEVEKVEKVEKVDEEDLAAARESPAASRAALD
ASFEFRGTDESAPSAPSPENVGLVEAAAKLAASEAKAASAFPSSPSRPPSSSPPAASASL
VPDPASGTYRGAGRSLAVAPPSTKHGITVTPFDVARQQREIYVPNVKVGLVIGKGGSHVV
YFQHQSGCAIHIARDAGEIPGGVNYVVPPSAYADPSDDAVTADGMRRITLLGGEHQTMMA
ADMIRRLVESSAERCDRTTERQHAIEAGHALPPLPPAAAAAADRDRGFGNPETFGNVRST
RDSFSSHDASAPVNSAYVPGDGPYAHMPHNLSPFVGSGWGRDAASHVEVAATVSIPHRKV
GLIIGRGGENIRFLQQQTRAHIQIQSEHDMCPGQPERTVYLRGARESCAEAARMIQDLVD
GMFRIGTAAVIPPQPPVPSDGYHSGYSSGKERTAVSAYSLASHAAGDPAWHGQSHGQSHG
GIVGYASSGSLGSGTNEPLGGGNGVGGGRVGGPPAAAAAAAAAAAAAAGGGAQPGYGYTG
SGYASDRRAATAAAAAAAAYPTAYPVAPVPTPVPAAPAAAYDYNVAAYGPMAGSMNAMGG
MGGMGAIGANPYAGQADPYAMGSDPSGAYAAAACAAYFANVPLHAAHAQIRAMGYADPAA
TMQYWQQCLDCYSRGYPAMPGYPSAGGGYAGVAAPAPAAPSAPSAPSAPSAPAAAPLPAS
DPAPLRKASAASSVGKADGDGDSESAARTAAVVGDAEDGASATSDVAAPSSGSGSDEA
Download sequence
Identical sequences C1E2P7
XP_002500694.1.63511 jgi|MicpuN2|99702|fgenesh2_pg.C_Chr_03000483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]