SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIMG_01025T0 from Coccidioides immitis RS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIMG_01025T0
Domain Number 1 Region: 56-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.95e-53
Family NQO2-like 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CIMG_01025T0
Sequence length 264
Comment | CIMG_01025 | Coccidioides immitis RS NADH-ubiquinone oxidoreductase 24 kDa subunit (265 aa)
Sequence
MASKLLPFTLRQCRQSFRHIPVRQCRQFTAATPVLSDILAVHRNTPENNPSIPFKFSEQN
LKVIDEILKRYPPQYKKAAVMPLLDLGQRQLGWTSISVMNEVARILEMPPMRVYEVATFY
TMYNREPVGKYFVQICTTTPCQLGGCGSDKIVEAITKHLGVSSHGQTTPDKLFTVLEVEC
LGACVNAPMVQINDDYYEDLTPETAVQLLNALKESALAGESGKKVNIPSPGPMSGRESCE
NSAGLTSLTSPLWSTETLRKDGEL
Download sequence
Identical sequences A0A0J7AUE7 A0A0J8RFQ7 J3KI96
CIHT_01241 CIRT_01084 XP_001247254.1.59393 CIMG_01025T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]