SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000004 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000004
Domain Number 1 Region: 26-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.08e-86
Family Eukaryotic proteases 0.0000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000004   Gene: ENSDORG00000000006   Transcript: ENSDORT00000000005
Sequence length 402
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_17877:18794:24255:-1 gene:ENSDORG00000000006 transcript:ENSDORT00000000005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVEMLPTAVLLVLAVSVVAKENTTCDGPCGLRFRQSSQGPVRIVGGQPVQHGAWPWMVSL
QIFMSHNSRRYHACGGTLLNSNWVLTAAHCFDNRKKVYDWRLVFGAQEIEYGSNKPVKAP
LQERYVEKIVIHEKYNVVTEGNDIALLKVTPAVTCGRFIGPGCLPHFKAGPPKVPQTCYV
TGWGYIKENAPRPSPILLEARVDLLDLDLCNSTQWYNGRVTSTNVCAGYPAGKIDTCQGD
SGGPLMCKDSADSPFVVVGITSWGVGCARAKRPGIYTATWDYLDWIASKIGPNALHMIQP
ATPHPPTTHASSSHLPSSNPAWYFENPPHAAQFPHSPLSASALPQHPSQPLPPPPLSHTK
PPKALSFAKRLQQLIEALRGRPYSVAKNSYYMGPTEYPEQSS
Download sequence
Identical sequences ENSDORP00000000004 ENSDORP00000000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]