SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000042 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000042
Domain Number 1 Region: 157-264
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-23
Family Dual specificity phosphatase-like 0.0000953
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000042
Domain Number - Region: 15-102
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0863
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000042   Gene: ENSDORG00000000053   Transcript: ENSDORT00000000053
Sequence length 264
Comment pep:novel scaffold:dipOrd1:scaffold_17787:12814:24947:1 gene:ENSDORG00000000053 transcript:ENSDORT00000000053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYIKKIANRIVSSIAFRLLGLLLIFVDLALMVTDIAVTSSKLYIPLEYRSISFVIALYFL
VDILLQVYVKGNKHYFSDILNILDAVIIGIILLIDVTYIFFYAGFFKDIQXXXXXXXXXX
XXXXXXXXXXXXQKRHLERVIRRLVSGNKRRYDKDGFDLDLTYITERLIAMSFPSSGKHS
FYRNPMEEVTRFLESRHAEHYFVYNLCSERSYDPKFFHHRMHRIMIDDHNVPSLEEMILF
SKEVIAWLSKDPQNIIVIHCKGGK
Download sequence
Identical sequences ENSDORP00000000042 ENSDORP00000000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]