SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000082 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000082
Domain Number 1 Region: 87-383
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.49e-98
Family Phosphofructokinase 0.000000543
Further Details:      
 
Domain Number 2 Region: 423-676
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.32e-78
Family Phosphofructokinase 0.0000266
Further Details:      
 
Domain Number 3 Region: 736-816
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.00000235
Family Phosphofructokinase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000082   Gene: ENSDORG00000000094   Transcript: ENSDORT00000000094
Sequence length 849
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_696:73560:114954:1 gene:ENSDORG00000000094 transcript:ENSDORT00000000094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEEFHLQFFMCVIQSRRVVRTSQTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKSGKITAEEASKSSFLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLTETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXTKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLFDELCIPFVVIPATV
SNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGGSPTPFDRNFATKMGAKAMNWMFGKIKESYRNGRIFANSPDSCV
LGMRKRAVFQPVTELKDQTDFDHRIPKEQWWLKLRPILKILAKYEIELDTSEHAHLEHIS
RKRSGEATV
Download sequence
Identical sequences ENSDORP00000000082 ENSDORP00000000082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]