SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000083 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000083
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 243-286
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000641
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000083   Gene: ENSDORG00000000095   Transcript: ENSDORT00000000095
Sequence length 288
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_696:120359:124685:-1 gene:ENSDORG00000000095 transcript:ENSDORT00000000095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVKVI
NLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVAKDQQLCEKL
TVLCSAPGTLKTLSRYAVRHSLSLQYLPDAVKGLPLPASLKEYLLLVE
Download sequence
Identical sequences ENSDORP00000000083 ENSDORP00000000083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]