SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000122 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000122
Domain Number 1 Region: 84-144
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000693
Family AN1-like Zinc finger 0.0017
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000131
Family AN1-like Zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000122   Gene: ENSDORG00000000133   Transcript: ENSDORT00000000134
Sequence length 175
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4349:16049:17353:1 gene:ENSDORG00000000133 transcript:ENSDORT00000000134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMRLTCDRCGR
NFCIKHRHPLDHDCSGEGHSTSRAGLAAISRAQSLTSTTTVPSPSRTLPSSTSPS
Download sequence
Identical sequences ENSDORP00000000122 ENSDORP00000000122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]