SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000129 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000129
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-69
Family Hemopexin-like domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-55
Family Matrix metalloproteases, catalytic domain 0.0000000262
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000129
Domain Number - Region: 86-98
Classification Level Classification E-value
Superfamily PGBD-like 0.0968
Family MMP N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000129   Gene: ENSDORG00000000144   Transcript: ENSDORT00000000141
Sequence length 584
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5391:7602:18721:1 gene:ENSDORG00000000144 transcript:ENSDORT00000000141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPSRCLLLPLLTLGTALASLGSAQSSNFSPEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXAMKRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREIPYAYIREGHEKQADIMIL
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDLFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGSPTKIPSQPRTT
SWPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPPSINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEAAEETEEAEVIIIEVDEEGRGAVN
AAAIVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences ENSDORP00000000129 ENSDORP00000000129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]