SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000137 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000137
Domain Number 1 Region: 479-584
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000103
Family Ankyrin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000137
Domain Number - Region: 70-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00745
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000137   Gene: ENSDORG00000000149   Transcript: ENSDORT00000000149
Sequence length 714
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4349:41542:48623:1 gene:ENSDORG00000000149 transcript:ENSDORT00000000149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTSAPAPASTSVSLFDLSVDAPVLQGLSLVSQVLGEPGVRAPCTNSPGSGERASPERK
VSQGPLDISEKFSCSACDQTFQNYQEQREHYKLDWHRFNIKQRLKNKSLLSALDFEKQSS
TGDLSSISGSEDSDSASEEDLKTLGEKTELEKPNQPRGFYPCRVLFQNAQGQFLYAYRCV
LGPHQVSPEEAEQLLQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVRDLLAEPDWAKALREAGTILLRAPRS
GRSLFFGGHGAPLQREDPRLWDIPLTTRRPTFRELQRVLNKLTTLHIYGEDPREIVRLRS
SQTHWKTVKEKRKATEDERDNVPSDESKELEQNEESPKDSASEEDGSPVELELVELTLET
LSLREYELLPKRRRKKTKKKRSQDQEAGALEQLEEDEPSSQSFQVVAAPLVDEAKAPGQP
ELWDVLLAACRAGDIGVLKVQLAAGPEDTGVMSLLSAPLGSGGFTLLHAAAAAGRGSVVR
LLLEAGADPTVRDSQAQPPYTVAADRSTRNEFRRFMEKNPDAYDYNKAQVPGPLTPEMEA
QQATRKRKQKAARRQREEQQRKQQEQEEREQEEQRRFASLSDREKRALAAERRLAAQLGA
PSPPIPDSAVISAGRCWSCGASLQGLVPFHYLDFSFCSTRCLRDHRNRAGKPSS
Download sequence
Identical sequences ENSDORP00000000137 ENSDORP00000000137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]