SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000159 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000159
Domain Number 1 Region: 52-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-72
Family Calnexin/calreticulin 0.0000000432
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.83e-56
Family P-domain of calnexin/calreticulin 0.000000444
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000159
Domain Number - Region: 402-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000348
Family Calnexin/calreticulin 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000159   Gene: ENSDORG00000000175   Transcript: ENSDORT00000000175
Sequence length 607
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_11185:1634:25648:1 gene:ENSDORG00000000175 transcript:ENSDORT00000000175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFRGLGLCLGLLFISANADFADDSVEVEDFGENSEEMDAEEATPSPEVFKYKTPQPIGEV
YFTETFDSGKLAGWVLSKAKKDDMDSEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
AVAAALERPFVFADKPLIVQYEVNFQEGIDCGGAYIKLLADTDDLILENFYDKTSYTIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVLSPDDTFE
ILIDQKVVNKGSLLEDVVPPVNPPREIDDPNDKKPSEWDDRAKIPDPSAVKPDDWDENEP
VQIEDLSAVKPEGWLDDEPKFIPNPNAVKPDDWNEDLDGEWEAPRMPNPACHIGCGEWKP
PMIDNPKYKGVWRPPMVSNPDYQGIWSPQKVPNPDYFEDDHPFLLTSFRALGLELWSMTP
DIYFDNFIICSEKETADHWATEGWGVKLIVANANEPGVFTQLMVAAKERPWLWLIYFVTA
GLPIALITLFCWPRKVKKKYEVAASMKTDLCKPQTKGALEQEVHEEKAAPEQPADLEEEK
KQSDGEVPEKEEEGEPEERSQEEIEIIEGQEEGNKSGSEDEMKEADESTGSGDGPVKSLR
KRRVRKD
Download sequence
Identical sequences ENSDORP00000000159 ENSDORP00000000159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]