SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000223 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000223
Domain Number 1 Region: 246-298
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000463
Family Matrix metalloproteases, catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000223   Gene: ENSDORG00000000241   Transcript: ENSDORT00000000242
Sequence length 490
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_28831:5401:10402:-1 gene:ENSDORG00000000241 transcript:ENSDORT00000000242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCRPAQEFSFGPRALKDALVSSDEALQQRYASAFSPAERLFLAEAYNPRRTLFRPLLI
HSAFDWLLSRPEAPEDFQTFHASLQHRKPGPARKHIYLQPIDLSEGLGRPLLEQLRSCAE
AFFLGLRVTCLPSVAAATIHCSSRPSQDSDGLQLHTDGLLSFLKSTKPEDALCVLGLTLA
DLYPHDTWTFTFGKFLPGQEVGICSFARFSEFPGPSTPEAAAGRGAADGPEASPQDSGGS
LGVAQCCKVACHELCHLLGLGSCRWLHCLMQGALSLDEALRRPPDLCPICLRKLQHVLGF
RLVDRYKRLYAWTRAAAAGPWPGPEAGEWSASEDTLPFSADSGLCCDSDSEPVTSLSEPL
TPDVWGHAFPEGPEDGLGSLATSEAVPRLRGPEEDLEEHGQWLAACIQALEREATEDDLA
QVDRAVDAMGRWELFTGQLPATRQAQPCGRDSPGLRKVLGDKLSSLRRRLSTRRVPKAGS
SPCGWEGAEN
Download sequence
Identical sequences A0A1S3FRE3
ENSDORP00000000223 XP_012878930.1.60039 ENSDORP00000000223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]