SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000292 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000000292
Domain Number - Region: 246-295
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00157
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000292   Gene: ENSDORG00000000312   Transcript: ENSDORT00000000314
Sequence length 571
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5741:16026:312713:1 gene:ENSDORG00000000312 transcript:ENSDORT00000000314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAQTWRVGVRCLLLLALLGSSPSEGVETCEEVRKLFQWRIVGAVKGLPDSPRAGADLQV
CISEKPTCCTRKMEERYQIAARQDLQQVLQASSAALKLLISRNAAAFQETLETLIKQAEN
YTSILFCNTYRNMALEVVVSIQEFFTDVGLYLFGADVNLEEFVNRFFDSLFPLVYNHLIN
PSVTESSLEDSECLRMARREVSPFGNVPKRVMGQMGRSLLPSRTFLQALNLAIEVINTTD
HLHFSKECSRALLKMQYCPHCQGLSLSKPCMGYCLNVARGCLAHMAELNPHWHAYIRSLE
ELSDAMHGTYDVEHVLLNFHLLVNDAVMQAHLNGQKLSEQVNKICGHQITMPTQSPRCSF
DLSKEKHGMKIFARNGEETLANRRKEFINSLRLYRSFYGGLADQLCIKELAAADGLPCWN
GEAVQSYTQRVVGGGMKAQSGNPEVKVKGTDPVINQIIDKLRHVIQLLQGRSPKPDKWEV
LHMGSGGGTVEQISGDCDDEDGCGGSGSGEVKRTLQITNWMPDDMNFSDVKQIHQKDHSS
TLDTTGAGCAAGTECMALSLMGALMLLPSLW
Download sequence
Identical sequences ENSDORP00000000292 ENSDORP00000000292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]