SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000298 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000298
Domain Number 1 Region: 518-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000791
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 50-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000087
Family SPRY domain 0.074
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000298
Domain Number - Region: 723-882
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00633
Family SPRY domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000298   Gene: ENSDORG00000000321   Transcript: ENSDORT00000000320
Sequence length 1555
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4251:24757:39221:-1 gene:ENSDORG00000000321 transcript:ENSDORT00000000320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMAAGSGGSGGSGGGPGPGPGGGGGGGGPGPGSSGSLGSGGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSA
TGLKGGSWVVSGCSVLKDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGV
AATGLPARVWAVVDLYGKCTQITVLPPEPGFSPPTPIPTPPLEPSAPPEDSALAQQGTSG
DEAFMVSPAQARPESFPNNLESHNDFASMELSEVVSNAILSAYNGGLLNVNLSSPPARDG
LGSSGAATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVMTNRPLRDNE
MFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRRE
YCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVTI
VHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTAL
RPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMTN
LRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPAA
WNVPPGVYAVVDLYGQAAQATIVDDLEVPPVPEPLSEGNNQVSPSSPSSGAGASDLRFHQ
LHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAGV
TAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTAK
GDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTATEK
SFPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRVAGYAHGLVFSTKELKADEVFEVKVE
ELDEKWAGSLRLGLTTLAPGEMGPGAGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQLQR
MNYGRNLERLGVGSRVGIRRGTDDTMHILVDGEDMGPAASGIAKNVWAVLDLYGPVRSVS
IVSSSRIEEPESTQPPSPSSDTGSEGEDDDEGEERGLGDQNQVGIIPTALEFLENHGKNI
LLSNGNCTATRVASYNQGIVVISQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCPPERLN
FPASACALKRAAWLLRGRGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLHVNG
VDQGVAVPDVPQPCHALVDLYGQCEQTIVSPEPGANKSAGQRDGEADMVDGIKESVCWGP
PPTASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEAHRRRGEPP
REYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAGSASILSC
RPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAEPLASKVQFRDPKSQRTHQA
QVAFQVCVRPGSYTPGPPSAALREPPDPHFSPAELEWVTKEKGATLLYALLVRVE
Download sequence
Identical sequences ENSDORP00000000298 ENSDORP00000000298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]