SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000302 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000302
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.01e-64
Family BAR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.42e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.00095
Further Details:      
 
Domain Number 3 Region: 260-361
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-26
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 585-691
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.19e-22
Family Ankyrin repeat 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000302   Gene: ENSDORG00000000323   Transcript: ENSDORT00000000324
Sequence length 738
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4251:46767:66107:1 gene:ENSDORG00000000323 transcript:ENSDORT00000000324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFI
VGICDLARLGPPEPMMAECLDKFTVSLNHKLDSHSELLDATQHTLQQQIQTLVKGLRDFR
EARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVIE
DKRKFDIMEFVLRLVEAQATYFQQGHEELSQLAQYRKELGAQLHQLVLNSAREKRDMEQR
HVLLKQKELGGEEPEPSLKEGPNGLVMEGHLFKRASNAFKTWSRRWFTIQNNQLVYQKKY
KDPVTVVVDDLRLCTVKHCPDSERRFCFEVVSTSKSCLLQADSEHLLHLWINAVQSSIAS
AFSQARLDDSPRGLSQGSGPLALGYAATLGCGGTVRGREPGGVGHVAALVQSVDGNAQCC
DCREPAPEWASINLGVTLCIECSGIHXXXXXXXXXXXXXXXXXXXXXXVKLMCELGNVVI
NQIYEARVEAMAVKKPGPTCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPPRGHPP
VPRKPGIKPRPGNVSKPETPSDDLGSLHPGALLFRSAGHPSSLPTMADALAHGADVNWVN
GGQENATPLIRSTAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKR
GADLGAQDSEGRDALTIAMETANADIVTLLRLAKMREAEAAQGQGGDETYLDIFRDFSLM
ASDDPEKLSRRSHDLYTL
Download sequence
Identical sequences ENSDORP00000000302 ENSDORP00000000302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]