SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000322 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000322
Domain Number 1 Region: 40-70
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000151
Family LIM domain 0.0044
Further Details:      
 
Domain Number 2 Region: 10-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000045
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000322
Domain Number - Region: 116-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0673
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000322   Gene: ENSDORG00000000346   Transcript: ENSDORT00000000344
Sequence length 147
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_280:1116:9692:-1 gene:ENSDORG00000000346 transcript:ENSDORT00000000344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQMLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKA
NLILCRRDYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFCVGDKF
FLKNNMILCQTDYEEGLMKEGYAPQVR
Download sequence
Identical sequences ENSDORP00000000322 ENSVPAP00000003821 ENSVPAP00000003821 ENSDORP00000000322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]