SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000324 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000324
Domain Number 1 Region: 115-436
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.31e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000991
Further Details:      
 
Domain Number 2 Region: 488-578
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000259
Family Ricin B-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000324   Gene: ENSDORG00000000349   Transcript: ENSDORT00000000346
Sequence length 582
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2174:11564:46109:1 gene:ENSDORG00000000349 transcript:ENSDORT00000000346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRAARRRCPRGLRRGREALLALLALLALAGLGAVLRTRRGAGTAQPGSPSTPRPPRSG
RREPVLPRPELSEDALGARGEAVRLPLEGVELRMQQESIQLHQINTYLSDRISLHRRLPE
RWNPLCKEKKYDFENLPRTSVVIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSN
REHLKERLAEELSALPKVRLIRANKREGLVRARLLGASMARGEVLTFLDCHCECHEGWLE
PLLQRIYEKESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHVVPDRERIQMR
SPIDVIRSPTMAGGLFAVNKNYFEYLGSYDTGMEVWGGENLEFSFRIWQCGGTLEIHPCS
HVGHVFPKQAPYSRSKALANSVRAAEVWMDEYKEIYYHRNPHARMEPFGDVSERRQLRAK
LQCKDFKWFLDTVYPELRVPEDRPGFFGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXFFEYTSQKEIRYNTRQPEGCIAVEVGTDVLIMQLCKETVPENQKFILRSDGSL
VHEQSKKCVQAVNKDSSNSFVPLLRECTNSDHQKWFFKENMS
Download sequence
Identical sequences ENSDORP00000000324 ENSDORP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]