SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000337 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000337
Domain Number 1 Region: 195-320
Classification Level Classification E-value
Superfamily C-type lectin-like 5.92e-19
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 2 Region: 66-211
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0000000968
Family HBL-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000337   Gene: ENSDORG00000000361   Transcript: ENSDORT00000000360
Sequence length 325
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5940:46264:51632:-1 gene:ENSDORG00000000361 transcript:ENSDORT00000000360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNATEEASSAHFTVDKQNISLWPQETLPKQGPNLVLRQPLTVRVVLICLSLTLATSVVLQ
VILYPWLMGTLSDVKTDAQVLKSRVDNISTLGSKVLKNSKGMEAAGSQIQMLHVSLDQVN
SHISTLRNSVDKANAQIQNLTRSWKEVDSLNSQIPELKRDFDKANTLHAKVQGLQSSLEN
ISKLLKEQNDVLQMVSQGWKYFRENFYYFSHTPKTWYSAQQFCVSRNSNLASVTSEAEQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFWIPGEPNNLGNNEHCGNIKV
SSLKSWNDDSCDSKLLFICKAPSEL
Download sequence
Identical sequences ENSDORP00000000337 ENSDORP00000000337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]