SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000372 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000372
Domain Number 1 Region: 654-768,933-986
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000983
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000372
Domain Number - Region: 452-557
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00229
Family N-acetyl transferase, NAT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000372   Gene: ENSDORG00000000395   Transcript: ENSDORT00000000395
Sequence length 1225
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2776:188992:677236:1 gene:ENSDORG00000000395 transcript:ENSDORT00000000395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILTSPRGKVEVIHCRRTESQDIYCIKNLIRKFTQKLFGRLNIIYLLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLNTLFLHLFVAVDEYSTGCCK
EIIXXXXXXXXXXXXXXXXXXXXXXXXSTLITVFDQVGTVPSLSYSEDFAVYICYRENHY
PQLHIRRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEGVAVG
FMSVCSRVNMTLLHECFDLGPFHGLCVPHPDDVLEPPQASNIDNSQGAFLKILKSREQVP
PEVLEQFQSKIMDDLRLDESLSALSDSDIQDIGKPFSDTSIGHKLDLSESSTLQLWPEEP
SNFHPTYKGASAVFCIQLFCIDEKYEARQVLSLDFMSFVFSLFPDKDFCMISLPHLTPEF
VLVQNFVKIIPFNNCSLNHDLYVFHRAGLLKSINIRLANIMDTYKVENLVKTLMLNKKIL
EDFVQYNAAFKDLEGTPMRTFVAEVAEQIVGIAVIKNEMDIEYIRSHYNIEDFIYFSHHQ
REEHGHLFHFALNPIFRHYTKFFLKEILRLDYKSCLYYPIYPQTRESKFQNPYAHSLTSA
LHYLVPVRPRRQIVYPLEKLGINAPSKSVSKDLSAYALYHTNRKLTLEPKITVNARIVVV
GASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKKPYSEERKFLASDHCFNDKDYALMS
LCSWVNVVVGRMIAIDRAAKQIVLSQDEIMFYDHLILCTGQQYQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEGNVIVYGNTLDTYTTVEA
LLHIGVRGSCIYLVHPPLKSVTTCLNNSTVEKAVAEALEEAGVITHKDALLAQWEMDPFS
DFIHTVYFTTYTKPFSLPCSIFFSFYEKNVDYDTFKAFNDACLVYDGRLVIDTNFHTNDI
AIRAAGSLTKFSNRYYANDWTHSNFSSKEIGFQLAAAMLNLFDPTLEPVTEPPADLDRLI
PMYKGAKIQGGILPGSYYYLHIAKPAIPTPLEVLMAQPDFGSQLITGNAKEGTYFRIHIN
RYRIIETITCLSKTPFPVSNYLRLFGQHEQTLNNLSDRYDDKLISDFYXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEEGLLSMEQLAHKIEDEEISLVEKPREYLKRVFEDSIYKSL
VEKSILEYLHYNYYHLPMYAWPGII
Download sequence
Identical sequences ENSDORP00000000372 ENSDORP00000000372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]